BLASTX nr result
ID: Sinomenium22_contig00053046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00053046 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856522.1| hypothetical protein AMTR_s00046p00132680 [A... 59 7e-07 >ref|XP_006856522.1| hypothetical protein AMTR_s00046p00132680 [Amborella trichopoda] gi|548860403|gb|ERN17989.1| hypothetical protein AMTR_s00046p00132680 [Amborella trichopoda] Length = 1089 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/64 (43%), Positives = 43/64 (67%) Frame = -1 Query: 199 FLQIIFDPLAQWLSVCAPTHGVV*EVSIINELQLFWEESLNYLQMS*PPIIFYSSFLKTQ 20 F++II DPLAQWLS+C+ + + ++L +FW E+L+ L+ S PP++F SS L Q Sbjct: 868 FMEIISDPLAQWLSLCSILNQETNRGDLQHQLSIFWTETLDCLRRSKPPLLFNSSLLTLQ 927 Query: 19 ASIL 8 A +L Sbjct: 928 APLL 931