BLASTX nr result
ID: Sinomenium22_contig00052915
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00052915 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844776.1| hypothetical protein AMTR_s00016p00259280 [A... 58 1e-06 >ref|XP_006844776.1| hypothetical protein AMTR_s00016p00259280 [Amborella trichopoda] gi|548847247|gb|ERN06451.1| hypothetical protein AMTR_s00016p00259280 [Amborella trichopoda] Length = 263 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -1 Query: 236 PHGRSKSWGWAFASPMRAFRLSSSSSAKLEDDKDNSTGNAA 114 PH RSKSWGWAFASP+RAFR SSSS+ KL + +D GN A Sbjct: 211 PHSRSKSWGWAFASPIRAFRPSSSSATKLPNRRDE--GNVA 249