BLASTX nr result
ID: Sinomenium22_contig00052863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00052863 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279821.1| PREDICTED: pentatricopeptide repeat-containi... 46 6e-08 emb|CBI36158.3| unnamed protein product [Vitis vinifera] 46 6e-08 ref|XP_007024106.1| Pentatricopeptide repeat (PPR-like) superfam... 46 8e-08 ref|XP_007216985.1| hypothetical protein PRUPE_ppa002680mg [Prun... 46 1e-07 ref|XP_003542104.1| PREDICTED: pentatricopeptide repeat-containi... 42 2e-06 ref|XP_006478024.1| PREDICTED: pentatricopeptide repeat-containi... 41 2e-06 ref|XP_004157025.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 40 2e-06 ref|XP_004151539.1| PREDICTED: pentatricopeptide repeat-containi... 40 2e-06 ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Popu... 40 3e-06 gb|EYU21550.1| hypothetical protein MIMGU_mgv1a002764mg [Mimulus... 43 4e-06 ref|XP_003597780.1| Beta-D-galactosidase [Medicago truncatula] g... 43 4e-06 ref|XP_006441042.1| hypothetical protein CICLE_v10023415mg [Citr... 40 4e-06 ref|XP_006346579.1| PREDICTED: pentatricopeptide repeat-containi... 41 5e-06 ref|XP_004486725.1| PREDICTED: pentatricopeptide repeat-containi... 42 8e-06 ref|XP_007150666.1| hypothetical protein PHAVU_005G171500g [Phas... 43 8e-06 >ref|XP_002279821.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like [Vitis vinifera] Length = 725 Score = 46.2 bits (108), Expect(2) = 6e-08 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 + G+ + WKTIQ+MV S CVIGPA+LSEIV+ Sbjct: 136 EAGMLGEMWKTIQEMVRSTCVIGPADLSEIVK 167 Score = 36.2 bits (82), Expect(2) = 6e-08 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALS+FYQIK Sbjct: 170 GKAKMVNKALSIFYQIK 186 >emb|CBI36158.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 46.2 bits (108), Expect(2) = 6e-08 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 + G+ + WKTIQ+MV S CVIGPA+LSEIV+ Sbjct: 136 EAGMLGEMWKTIQEMVRSTCVIGPADLSEIVK 167 Score = 36.2 bits (82), Expect(2) = 6e-08 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALS+FYQIK Sbjct: 170 GKAKMVNKALSIFYQIK 186 >ref|XP_007024106.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618658|ref|XP_007024107.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618661|ref|XP_007024108.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618664|ref|XP_007024109.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618669|ref|XP_007024110.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|590618672|ref|XP_007024111.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779472|gb|EOY26728.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779473|gb|EOY26729.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779474|gb|EOY26730.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779475|gb|EOY26731.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779476|gb|EOY26732.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] gi|508779477|gb|EOY26733.1| Pentatricopeptide repeat (PPR-like) superfamily protein isoform 1 [Theobroma cacao] Length = 636 Score = 45.8 bits (107), Expect(2) = 8e-08 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 + G+ + WKTIQ+M+ S C IGPAELSEIVR Sbjct: 134 EAGLVGEMWKTIQEMLRSTCAIGPAELSEIVR 165 Score = 36.2 bits (82), Expect(2) = 8e-08 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALS+FYQIK Sbjct: 168 GKAKMVNKALSIFYQIK 184 >ref|XP_007216985.1| hypothetical protein PRUPE_ppa002680mg [Prunus persica] gi|462413135|gb|EMJ18184.1| hypothetical protein PRUPE_ppa002680mg [Prunus persica] Length = 645 Score = 45.8 bits (107), Expect(2) = 1e-07 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 + GV + WKTIQ+M+ S CVI PAELSEI+R Sbjct: 136 EAGVVGEMWKTIQEMIRSTCVIEPAELSEIIR 167 Score = 35.4 bits (80), Expect(2) = 1e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+AKMVNKALSVFYQIK Sbjct: 170 GRAKMVNKALSVFYQIK 186 >ref|XP_003542104.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Glycine max] Length = 631 Score = 42.4 bits (98), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 129 QFWKTIQDMVHSNCVIGPAELSEIVR 52 + WKTIQDMV +C + PAELSEIVR Sbjct: 136 EVWKTIQDMVKGSCAMAPAELSEIVR 161 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVN+ALSVFYQ+K Sbjct: 164 GKAKMVNRALSVFYQVK 180 >ref|XP_006478024.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Citrus sinensis] gi|568848458|ref|XP_006478025.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X2 [Citrus sinensis] gi|568848460|ref|XP_006478026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X3 [Citrus sinensis] gi|568848462|ref|XP_006478027.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X4 [Citrus sinensis] gi|568848464|ref|XP_006478028.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X5 [Citrus sinensis] gi|568848466|ref|XP_006478029.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X6 [Citrus sinensis] gi|568848468|ref|XP_006478030.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X7 [Citrus sinensis] gi|568848470|ref|XP_006478031.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X8 [Citrus sinensis] gi|568848472|ref|XP_006478032.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X9 [Citrus sinensis] Length = 638 Score = 40.8 bits (94), Expect(2) = 2e-06 Identities = 17/25 (68%), Positives = 21/25 (84%) Frame = -2 Query: 129 QFWKTIQDMVHSNCVIGPAELSEIV 55 + WK+IQDMV S CV+GP+ LSEIV Sbjct: 143 EMWKSIQDMVRSTCVMGPSVLSEIV 167 Score = 36.2 bits (82), Expect(2) = 2e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALS+FYQIK Sbjct: 171 GKAKMVNKALSIFYQIK 187 >ref|XP_004157025.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g16010-like [Cucumis sativus] Length = 637 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -2 Query: 141 GVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 G+ + W+TIQDM+ S C +GPAE SEI++ Sbjct: 138 GLVDEMWRTIQDMIRSPCSVGPAEWSEILK 167 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALSVFYQIK Sbjct: 170 GKAKMVNKALSVFYQIK 186 >ref|XP_004151539.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like [Cucumis sativus] Length = 637 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -2 Query: 141 GVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 G+ + W+TIQDM+ S C +GPAE SEI++ Sbjct: 138 GLVDEMWRTIQDMIRSPCSVGPAEWSEILK 167 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALSVFYQIK Sbjct: 170 GKAKMVNKALSVFYQIK 186 >ref|XP_002299640.2| hypothetical protein POPTR_0001s18030g [Populus trichocarpa] gi|550347580|gb|EEE84445.2| hypothetical protein POPTR_0001s18030g [Populus trichocarpa] Length = 641 Score = 40.0 bits (92), Expect(2) = 3e-06 Identities = 19/33 (57%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHS-NCVIGPAELSEIVR 52 D G+ + WK IQ+MV S CVIGPA+LSE+V+ Sbjct: 139 DCGLFGEMWKMIQEMVRSPTCVIGPADLSEVVK 171 Score = 36.6 bits (83), Expect(2) = 3e-06 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALSVFYQIK Sbjct: 174 GKAKMVNKALSVFYQIK 190 >gb|EYU21550.1| hypothetical protein MIMGU_mgv1a002764mg [Mimulus guttatus] Length = 640 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -2 Query: 123 WKTIQDMVHSNCVIGPAELSEIVRARRR 40 WKTIQ+MV S C +GPA+LSEIVR R Sbjct: 143 WKTIQEMVKSPCAVGPADLSEIVRVLGR 170 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+AKMVNKALS+FY IK Sbjct: 169 GRAKMVNKALSIFYHIK 185 >ref|XP_003597780.1| Beta-D-galactosidase [Medicago truncatula] gi|357455013|ref|XP_003597787.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355486828|gb|AES68031.1| Beta-D-galactosidase [Medicago truncatula] gi|355486835|gb|AES68038.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 639 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = -2 Query: 129 QFWKTIQDMVHSNCVIGPAELSEIVR 52 + W+TIQDMV S C IGP+ELSEIV+ Sbjct: 143 ELWRTIQDMVKSPCAIGPSELSEIVK 168 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+ KMVNKALS+FYQ+K Sbjct: 171 GRVKMVNKALSIFYQVK 187 >ref|XP_006441042.1| hypothetical protein CICLE_v10023415mg [Citrus clementina] gi|557543304|gb|ESR54282.1| hypothetical protein CICLE_v10023415mg [Citrus clementina] Length = 638 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 123 WKTIQDMVHSNCVIGPAELSEIV 55 WK+IQDMV S CV+GP+ LSEIV Sbjct: 145 WKSIQDMVRSTCVMGPSVLSEIV 167 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 GKAKMVNKALS+FYQIK Sbjct: 171 GKAKMVNKALSIFYQIK 187 >ref|XP_006346579.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Solanum tuberosum] Length = 637 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 17/32 (53%), Positives = 23/32 (71%) Frame = -2 Query: 147 DIGVKIQFWKTIQDMVHSNCVIGPAELSEIVR 52 + G+ + WKT+Q+M S CVI PA+LSE VR Sbjct: 135 EAGLTGEMWKTVQEMARSTCVITPADLSETVR 166 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+AKMVNKALS+FYQIK Sbjct: 169 GRAKMVNKALSIFYQIK 185 >ref|XP_004486725.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Cicer arietinum] Length = 638 Score = 41.6 bits (96), Expect(2) = 8e-06 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -2 Query: 129 QFWKTIQDMVHSNCVIGPAELSEIVR 52 + W+TIQDMV S C GP+ELSEIV+ Sbjct: 143 ELWRTIQDMVKSPCAFGPSELSEIVK 168 Score = 33.5 bits (75), Expect(2) = 8e-06 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+ KMVNKALSVFYQ+K Sbjct: 171 GRVKMVNKALSVFYQVK 187 >ref|XP_007150666.1| hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] gi|561023930|gb|ESW22660.1| hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] Length = 632 Score = 43.1 bits (100), Expect(2) = 8e-06 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 123 WKTIQDMVHSNCVIGPAELSEIVR 52 WKTIQDMV +C +GPAELSEIV+ Sbjct: 139 WKTIQDMVKGSCAMGPAELSEIVK 162 Score = 32.0 bits (71), Expect(2) = 8e-06 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 52 GKAKMVNKALSVFYQIK 2 G+ KMVN+ALSVFYQ+K Sbjct: 165 GRIKMVNRALSVFYQVK 181