BLASTX nr result
ID: Sinomenium22_contig00052847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00052847 (298 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006588025.1| PREDICTED: mechanosensitive ion channel prot... 133 3e-29 ref|XP_006597867.1| PREDICTED: mechanosensitive ion channel prot... 132 4e-29 emb|CBI27835.3| unnamed protein product [Vitis vinifera] 132 7e-29 ref|XP_002278293.1| PREDICTED: uncharacterized protein At5g12080... 132 7e-29 ref|XP_002309474.2| hypothetical protein POPTR_0006s23910g [Popu... 129 3e-28 ref|XP_006474474.1| PREDICTED: mechanosensitive ion channel prot... 127 2e-27 ref|XP_006453017.1| hypothetical protein CICLE_v10010725mg, part... 127 2e-27 ref|XP_004303476.1| PREDICTED: mechanosensitive ion channel prot... 126 4e-27 ref|XP_002516120.1| conserved hypothetical protein [Ricinus comm... 124 1e-26 ref|XP_007203787.1| hypothetical protein PRUPE_ppa001792mg [Prun... 124 1e-26 ref|XP_007225112.1| hypothetical protein PRUPE_ppa002659mg [Prun... 124 2e-26 gb|EXB38917.1| Mechanosensitive ion channel protein 10 [Morus no... 123 3e-26 ref|XP_007012394.1| Mechanosensitive channel of small conductanc... 122 4e-26 ref|XP_007012392.1| Mechanosensitive channel of small conductanc... 122 4e-26 ref|XP_004305616.1| PREDICTED: mechanosensitive ion channel prot... 122 5e-26 ref|XP_004170731.1| PREDICTED: mechanosensitive ion channel prot... 121 9e-26 ref|XP_004144122.1| PREDICTED: mechanosensitive ion channel prot... 121 9e-26 ref|XP_007012692.1| Mechanosensitive channel of small conductanc... 121 1e-25 ref|XP_007012691.1| Mechanosensitive channel of small conductanc... 121 1e-25 ref|XP_006849626.1| hypothetical protein AMTR_s00024p00217410 [A... 119 3e-25 >ref|XP_006588025.1| PREDICTED: mechanosensitive ion channel protein 10-like [Glycine max] Length = 632 Score = 133 bits (334), Expect = 3e-29 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = -1 Query: 235 IEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFLI 56 +EW A VC++G L ASLT KLQH IWGLE+WKWCVLV+VI+CGRLVT WFI+VLVFLI Sbjct: 185 VEWFAFVCIMGFLIASLTDHKLQHWEIWGLELWKWCVLVLVILCGRLVTEWFINVLVFLI 244 Query: 55 ERNFLLRKKVLYFVYGLK 2 ERNFL +KKVLYFVYG+K Sbjct: 245 ERNFLFKKKVLYFVYGVK 262 >ref|XP_006597867.1| PREDICTED: mechanosensitive ion channel protein 10-like [Glycine max] Length = 748 Score = 132 bits (333), Expect = 4e-29 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = -1 Query: 235 IEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFLI 56 +EW A VC++G L ASLTV KLQH IWGLE+WKWCVLV VI+CGRLVT WFI+VLVFLI Sbjct: 184 VEWYAFVCIMGFLIASLTVHKLQHREIWGLELWKWCVLVSVILCGRLVTEWFINVLVFLI 243 Query: 55 ERNFLLRKKVLYFVYGLK 2 ERNFL +KKVLYFVYG++ Sbjct: 244 ERNFLFKKKVLYFVYGVQ 261 >emb|CBI27835.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 132 bits (331), Expect = 7e-29 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = -1 Query: 235 IEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFLI 56 +EWIA VC++GCL ASLTV +L H IWGLEIWKW VLV+VI CGRLVT W I+++VF+I Sbjct: 70 VEWIAFVCIMGCLIASLTVHRLLHTLIWGLEIWKWSVLVLVIFCGRLVTEWCINIVVFMI 129 Query: 55 ERNFLLRKKVLYFVYGLK 2 ERNFLLRKKVLYFVYGLK Sbjct: 130 ERNFLLRKKVLYFVYGLK 147 >ref|XP_002278293.1| PREDICTED: uncharacterized protein At5g12080-like [Vitis vinifera] Length = 772 Score = 132 bits (331), Expect = 7e-29 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = -1 Query: 235 IEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFLI 56 +EWIA VC++GCL ASLTV +L H IWGLEIWKW VLV+VI CGRLVT W I+++VF+I Sbjct: 198 VEWIAFVCIMGCLIASLTVHRLLHTLIWGLEIWKWSVLVLVIFCGRLVTEWCINIVVFMI 257 Query: 55 ERNFLLRKKVLYFVYGLK 2 ERNFLLRKKVLYFVYGLK Sbjct: 258 ERNFLLRKKVLYFVYGLK 275 >ref|XP_002309474.2| hypothetical protein POPTR_0006s23910g [Populus trichocarpa] gi|550336962|gb|EEE92997.2| hypothetical protein POPTR_0006s23910g [Populus trichocarpa] Length = 545 Score = 129 bits (325), Expect = 3e-28 Identities = 58/79 (73%), Positives = 67/79 (84%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 +IEW+A +C+LGCL ASLTV KL+ IW LE WKWCVLVMVI G LVT WF+HV+VFL Sbjct: 213 VIEWVAFLCILGCLIASLTVEKLEKTTIWSLEFWKWCVLVMVIFSGMLVTNWFMHVIVFL 272 Query: 58 IERNFLLRKKVLYFVYGLK 2 IERNFLL+KKVLYFV+GLK Sbjct: 273 IERNFLLKKKVLYFVHGLK 291 >ref|XP_006474474.1| PREDICTED: mechanosensitive ion channel protein 10-like [Citrus sinensis] Length = 758 Score = 127 bits (319), Expect = 2e-27 Identities = 56/79 (70%), Positives = 67/79 (84%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LI+W+A +C +GCL SLTV K ++ IWGLEIWKWCVLV+VI CG LVT WF+HV+VF+ Sbjct: 187 LIQWVAFLCNVGCLIVSLTVNKWENFMIWGLEIWKWCVLVLVIFCGMLVTNWFMHVIVFV 246 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+GLK Sbjct: 247 IETNFLLRKKVLYFVHGLK 265 >ref|XP_006453017.1| hypothetical protein CICLE_v10010725mg, partial [Citrus clementina] gi|557556243|gb|ESR66257.1| hypothetical protein CICLE_v10010725mg, partial [Citrus clementina] Length = 761 Score = 127 bits (319), Expect = 2e-27 Identities = 56/79 (70%), Positives = 67/79 (84%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LI+W+A +C +GCL SLTV K ++ IWGLEIWKWCVLV+VI CG LVT WF+HV+VF+ Sbjct: 190 LIQWVAFLCNVGCLIVSLTVNKWENFMIWGLEIWKWCVLVLVIFCGMLVTNWFMHVIVFV 249 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+GLK Sbjct: 250 IETNFLLRKKVLYFVHGLK 268 >ref|XP_004303476.1| PREDICTED: mechanosensitive ion channel protein 10-like [Fragaria vesca subsp. vesca] Length = 632 Score = 126 bits (316), Expect = 4e-27 Identities = 54/79 (68%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LIEW +C+LGCL ASLT++KLQH +WGLEIWKWCVLVMV+ G VT W +H+++F+ Sbjct: 70 LIEWFVFLCILGCLVASLTMKKLQHCMVWGLEIWKWCVLVMVVFSGMFVTNWVMHLMLFV 129 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+GLK Sbjct: 130 IEGNFLLRKKVLYFVHGLK 148 >ref|XP_002516120.1| conserved hypothetical protein [Ricinus communis] gi|223544606|gb|EEF46122.1| conserved hypothetical protein [Ricinus communis] Length = 762 Score = 124 bits (312), Expect = 1e-26 Identities = 54/79 (68%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 +I+WI VC+ GCL ASLTV+KL+ IWGLE WKWCVL++VI+ G +T WF+H +VF+ Sbjct: 190 VIQWITFVCLAGCLVASLTVQKLEKTMIWGLEPWKWCVLLLVIISGMFITNWFMHFIVFV 249 Query: 58 IERNFLLRKKVLYFVYGLK 2 IERNFLLRKKVLYFVYGLK Sbjct: 250 IERNFLLRKKVLYFVYGLK 268 >ref|XP_007203787.1| hypothetical protein PRUPE_ppa001792mg [Prunus persica] gi|462399318|gb|EMJ04986.1| hypothetical protein PRUPE_ppa001792mg [Prunus persica] Length = 763 Score = 124 bits (311), Expect = 1e-26 Identities = 58/79 (73%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LIE I VCV+G L A LTV KL+H IW LE+WKWCVLV+V++CGRLVT W I+VLVFL Sbjct: 183 LIELIVFVCVVGFLIACLTVTKLEHKKIWSLELWKWCVLVVVVLCGRLVTEWLINVLVFL 242 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLL+KKVLYFVYGLK Sbjct: 243 IEMNFLLKKKVLYFVYGLK 261 >ref|XP_007225112.1| hypothetical protein PRUPE_ppa002659mg [Prunus persica] gi|462422048|gb|EMJ26311.1| hypothetical protein PRUPE_ppa002659mg [Prunus persica] Length = 647 Score = 124 bits (310), Expect = 2e-26 Identities = 53/79 (67%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 L EW+ + +L CL +SLTV KL++ +WGLE+WKWCVLVMVI CG LVT WF+H +VF+ Sbjct: 75 LFEWVVFLGILACLVSSLTVEKLENFNMWGLEVWKWCVLVMVIFCGMLVTNWFMHFVVFV 134 Query: 58 IERNFLLRKKVLYFVYGLK 2 IERNFLLRKKVLYFV+G+K Sbjct: 135 IERNFLLRKKVLYFVHGMK 153 >gb|EXB38917.1| Mechanosensitive ion channel protein 10 [Morus notabilis] Length = 758 Score = 123 bits (308), Expect = 3e-26 Identities = 55/79 (69%), Positives = 68/79 (86%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LIEW++ VC++G L SLT+ +L+ +WGLE+WKW VLV+VI CGRLVT WFI+VLVFL Sbjct: 181 LIEWVSFVCIVGFLILSLTLHELEKKLVWGLELWKWGVLVLVIFCGRLVTEWFINVLVFL 240 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE+NFLL+KKVLYFVYGLK Sbjct: 241 IEKNFLLKKKVLYFVYGLK 259 >ref|XP_007012394.1| Mechanosensitive channel of small conductance-like 10, putative isoform 3 [Theobroma cacao] gi|590574415|ref|XP_007012395.1| Mechanosensitive channel of small conductance-like 10, putative isoform 3 [Theobroma cacao] gi|508782757|gb|EOY30013.1| Mechanosensitive channel of small conductance-like 10, putative isoform 3 [Theobroma cacao] gi|508782758|gb|EOY30014.1| Mechanosensitive channel of small conductance-like 10, putative isoform 3 [Theobroma cacao] Length = 631 Score = 122 bits (307), Expect = 4e-26 Identities = 55/79 (69%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 +IEW+ + +LGCL ASLTV KLQ +W L+IW+WCVLVMVI CG LVT WF+H++VFL Sbjct: 205 VIEWVVFLFLLGCLIASLTVDKLQKTSVWSLKIWQWCVLVMVIFCGMLVTHWFMHLIVFL 264 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+GLK Sbjct: 265 IELNFLLRKKVLYFVHGLK 283 >ref|XP_007012392.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] gi|590574408|ref|XP_007012393.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] gi|508782755|gb|EOY30011.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] gi|508782756|gb|EOY30012.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] Length = 779 Score = 122 bits (307), Expect = 4e-26 Identities = 55/79 (69%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 +IEW+ + +LGCL ASLTV KLQ +W L+IW+WCVLVMVI CG LVT WF+H++VFL Sbjct: 205 VIEWVVFLFLLGCLIASLTVDKLQKTSVWSLKIWQWCVLVMVIFCGMLVTHWFMHLIVFL 264 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+GLK Sbjct: 265 IELNFLLRKKVLYFVHGLK 283 >ref|XP_004305616.1| PREDICTED: mechanosensitive ion channel protein 10-like [Fragaria vesca subsp. vesca] Length = 751 Score = 122 bits (306), Expect = 5e-26 Identities = 54/79 (68%), Positives = 66/79 (83%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 L E + +C+LGCL ASLTV++L+H +WGLEIWKWCVLVMVI G LVT W +H++VFL Sbjct: 188 LTELVVFLCILGCLVASLTVKRLEHYMVWGLEIWKWCVLVMVIFSGMLVTNWVMHLIVFL 247 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE NFLLRKKVLYFV+G+K Sbjct: 248 IECNFLLRKKVLYFVHGMK 266 >ref|XP_004170731.1| PREDICTED: mechanosensitive ion channel protein 10-like, partial [Cucumis sativus] Length = 420 Score = 121 bits (304), Expect = 9e-26 Identities = 53/79 (67%), Positives = 65/79 (82%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 ++EWIA +C+ GCL ASLT+ L IWGL +WKWCVLV+VI CGRL + WFI+ LVFL Sbjct: 188 IVEWIAFLCLTGCLIASLTIETLVTKEIWGLGLWKWCVLVLVIFCGRLFSQWFINCLVFL 247 Query: 58 IERNFLLRKKVLYFVYGLK 2 IERNFLL++KVLYFVYGL+ Sbjct: 248 IERNFLLKRKVLYFVYGLR 266 >ref|XP_004144122.1| PREDICTED: mechanosensitive ion channel protein 10-like [Cucumis sativus] Length = 762 Score = 121 bits (304), Expect = 9e-26 Identities = 53/79 (67%), Positives = 65/79 (82%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 ++EWIA +C+ GCL ASLT+ L IWGL +WKWCVLV+VI CGRL + WFI+ LVFL Sbjct: 188 IVEWIAFLCLTGCLIASLTIETLVTKEIWGLGLWKWCVLVLVIFCGRLFSQWFINCLVFL 247 Query: 58 IERNFLLRKKVLYFVYGLK 2 IERNFLL++KVLYFVYGL+ Sbjct: 248 IERNFLLKRKVLYFVYGLR 266 >ref|XP_007012692.1| Mechanosensitive channel of small conductance-like 10, putative isoform 2 [Theobroma cacao] gi|508783055|gb|EOY30311.1| Mechanosensitive channel of small conductance-like 10, putative isoform 2 [Theobroma cacao] Length = 628 Score = 121 bits (303), Expect = 1e-25 Identities = 51/79 (64%), Positives = 68/79 (86%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LIE++A +C++G L ASLTV KL+ IWGLE+WKWCVL++VI CGRL T W ++++VFL Sbjct: 208 LIEFVAFICIMGLLIASLTVHKLEKTMIWGLELWKWCVLILVIFCGRLFTEWMMNIVVFL 267 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE+N+LL+KKVLYFV+GLK Sbjct: 268 IEKNYLLKKKVLYFVFGLK 286 >ref|XP_007012691.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] gi|508783054|gb|EOY30310.1| Mechanosensitive channel of small conductance-like 10, putative isoform 1 [Theobroma cacao] Length = 949 Score = 121 bits (303), Expect = 1e-25 Identities = 51/79 (64%), Positives = 68/79 (86%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 LIE++A +C++G L ASLTV KL+ IWGLE+WKWCVL++VI CGRL T W ++++VFL Sbjct: 208 LIEFVAFICIMGLLIASLTVHKLEKTMIWGLELWKWCVLILVIFCGRLFTEWMMNIVVFL 267 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE+N+LL+KKVLYFV+GLK Sbjct: 268 IEKNYLLKKKVLYFVFGLK 286 >ref|XP_006849626.1| hypothetical protein AMTR_s00024p00217410 [Amborella trichopoda] gi|548853201|gb|ERN11207.1| hypothetical protein AMTR_s00024p00217410 [Amborella trichopoda] Length = 785 Score = 119 bits (299), Expect = 3e-25 Identities = 52/79 (65%), Positives = 64/79 (81%) Frame = -1 Query: 238 LIEWIALVCVLGCLTASLTVRKLQHLPIWGLEIWKWCVLVMVIVCGRLVTAWFIHVLVFL 59 L+EW A + + GCL SLTV L+ IWGLEIWKWC++V+VI CGRLV+ WFI +LV L Sbjct: 214 LVEWTAFILITGCLICSLTVNPLKDRTIWGLEIWKWCLMVLVIFCGRLVSGWFITLLVLL 273 Query: 58 IERNFLLRKKVLYFVYGLK 2 IE+NF+LRKKVLYFVYGL+ Sbjct: 274 IEQNFMLRKKVLYFVYGLR 292