BLASTX nr result
ID: Sinomenium22_contig00052479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00052479 (530 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC19385.1| Dihydrolipoyllysine-residue acetyltransferase com... 48 2e-06 >gb|EXC19385.1| Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex [Morus notabilis] Length = 446 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 21/48 (43%), Positives = 27/48 (56%) Frame = -2 Query: 529 LDTSYKKWNLILFPFENAWLSHPTFISNLEACW*EVDSKGFEGFHFMK 386 LDT KW LF FEN WL HP+F E W ++ G+EG+ M+ Sbjct: 329 LDTHPVKWEPTLFRFENMWLDHPSFRKECEIWWGNMNPVGWEGYKIME 376 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = -1 Query: 389 EKLRSIKNRVK*WYSSTFGDINL 321 EKL+ +K+++K W +FGD NL Sbjct: 376 EKLKGLKDKLKTWNKESFGDTNL 398