BLASTX nr result
ID: Sinomenium22_contig00051216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00051216 (1026 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006474468.1| PREDICTED: pentatricopeptide repeat-containi... 85 5e-14 ref|XP_002279628.2| PREDICTED: pentatricopeptide repeat-containi... 83 2e-13 emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] 83 2e-13 ref|XP_006453029.1| hypothetical protein CICLE_v10007870mg [Citr... 81 6e-13 ref|XP_002308534.1| hypothetical protein POPTR_0006s23980g [Popu... 79 2e-12 ref|XP_006849607.1| hypothetical protein AMTR_s00024p00204830 [A... 74 1e-10 ref|XP_006578089.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-09 ref|XP_002516112.1| pentatricopeptide repeat-containing protein,... 67 9e-09 gb|EXB48288.1| hypothetical protein L484_003771 [Morus notabilis] 66 2e-08 ref|XP_007224434.1| hypothetical protein PRUPE_ppa021491mg [Prun... 64 1e-07 ref|XP_007136868.1| hypothetical protein PHAVU_009G080600g [Phas... 60 2e-06 >ref|XP_006474468.1| PREDICTED: pentatricopeptide repeat-containing protein At5g65560-like [Citrus sinensis] gi|343887304|dbj|BAK61850.1| PPR containing protein [Citrus unshiu] Length = 567 Score = 84.7 bits (208), Expect = 5e-14 Identities = 38/85 (44%), Positives = 59/85 (69%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CE+G+VE + + H+M+ K + I L+SFSV VK+LC KGKV+E +K+F+ RCP ++ Sbjct: 484 CEEGNVENVMQIAHEMVTKKYVIGLESFSVLVKQLCAKGKVTEAEKLFDTC-SRCPAVDV 542 Query: 845 DSYRRIMDENLCNIWSDLPDYWNSC 771 DSYRR++D+ +C S +Y +C Sbjct: 543 DSYRRVLDQQICIRSSSCSNYGENC 567 >ref|XP_002279628.2| PREDICTED: pentatricopeptide repeat-containing protein At1g63330-like [Vitis vinifera] Length = 563 Score = 82.8 bits (203), Expect = 2e-13 Identities = 38/72 (52%), Positives = 52/72 (72%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CEDG+ +MA+ + +M++ G+ INL+SF FVK L K K EV+K FEEM RRCP ++ Sbjct: 459 CEDGNADMAMRLFCEMLDMGYVINLESFLAFVKGLSAKEKAFEVEKFFEEMSRRCPGIDI 518 Query: 845 DSYRRIMDENLC 810 YRRI+DE+LC Sbjct: 519 HKYRRILDEHLC 530 >emb|CAN62945.1| hypothetical protein VITISV_002230 [Vitis vinifera] Length = 912 Score = 82.8 bits (203), Expect = 2e-13 Identities = 38/72 (52%), Positives = 52/72 (72%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CEDG+ +MA+ + +M++ G+ INL+SF FVK L K K EV+K FEEM RRCP ++ Sbjct: 543 CEDGNADMAMRLFCEMLDMGYVINLESFLAFVKGLSAKEKAFEVEKFFEEMSRRCPGIDI 602 Query: 845 DSYRRIMDENLC 810 YRRI+DE+LC Sbjct: 603 HKYRRILDEHLC 614 >ref|XP_006453029.1| hypothetical protein CICLE_v10007870mg [Citrus clementina] gi|557556255|gb|ESR66269.1| hypothetical protein CICLE_v10007870mg [Citrus clementina] Length = 567 Score = 81.3 bits (199), Expect = 6e-13 Identities = 38/81 (46%), Positives = 57/81 (70%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CE+G+VE + + H+M+ K + I L+SFSV VK+LC KGKV+E +K+F M RCP ++ Sbjct: 484 CEEGNVENVMRIAHEMVTKKYVIGLESFSVLVKQLCAKGKVTEAEKLF-GMCSRCPAVDV 542 Query: 845 DSYRRIMDENLCNIWSDLPDY 783 DSYRR++D+ +C S +Y Sbjct: 543 DSYRRVLDQQICIRSSSCSNY 563 >ref|XP_002308534.1| hypothetical protein POPTR_0006s23980g [Populus trichocarpa] gi|222854510|gb|EEE92057.1| hypothetical protein POPTR_0006s23980g [Populus trichocarpa] Length = 567 Score = 79.3 bits (194), Expect = 2e-12 Identities = 34/71 (47%), Positives = 52/71 (73%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CE G+ EMA+ +D + K + INL SFS FV +CGKGKV E +++F++M RRC + ++ Sbjct: 490 CEAGNEEMAMRAFYDSINKNYVINLQSFSFFVNLMCGKGKVIEAEQIFKDMCRRCSLVDV 549 Query: 845 DSYRRIMDENL 813 DSY+R++D+ L Sbjct: 550 DSYQRVLDDQL 560 >ref|XP_006849607.1| hypothetical protein AMTR_s00024p00204830 [Amborella trichopoda] gi|548853182|gb|ERN11188.1| hypothetical protein AMTR_s00024p00204830 [Amborella trichopoda] Length = 550 Score = 73.6 bits (179), Expect = 1e-10 Identities = 33/67 (49%), Positives = 47/67 (70%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CE+ D+ MA+ + H+M+EKG IN+ FS VKEL G+ SE + VF+EM RRC +P+ Sbjct: 479 CENDDLAMALGVFHEMIEKGLAINVQGFSAIVKELRQNGRTSEAENVFKEMFRRCHVPDE 538 Query: 845 DSYRRIM 825 +SY RI+ Sbjct: 539 ESYARIL 545 >ref|XP_006578089.1| PREDICTED: pentatricopeptide repeat-containing protein At4g11690-like [Glycine max] Length = 551 Score = 67.8 bits (164), Expect = 7e-09 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPI 855 CED D EMA ++D+M+K F IN D F FVK LC KGK+ E + V EEMRRRC + Sbjct: 486 CEDRDEEMAQKTVYDIMDKNFVINQDIFCTFVKLLCAKGKLKEAETVSEEMRRRCQL 542 >ref|XP_002516112.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223544598|gb|EEF46114.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 461 Score = 67.4 bits (163), Expect = 9e-09 Identities = 29/71 (40%), Positives = 49/71 (69%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CEDG+ EMA +L++ ++ + I+ +SFSVF ++C KGK V+ + +EM +RC + ++ Sbjct: 383 CEDGNEEMAKQVLYEAIDNNYVIDSESFSVFANKMCEKGKAVGVENILKEMCKRCSVVDV 442 Query: 845 DSYRRIMDENL 813 +Y RI+DE L Sbjct: 443 GNYWRILDEQL 453 >gb|EXB48288.1| hypothetical protein L484_003771 [Morus notabilis] Length = 563 Score = 66.2 bits (160), Expect = 2e-08 Identities = 26/72 (36%), Positives = 49/72 (68%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CEDG+V+ A+ + ++ +++ + INLDSFS + LC G+ E +F+++ RRC + Sbjct: 480 CEDGNVDKAMRVFNETLDRNYIINLDSFSALINALCAAGRHKEAITIFKDVSRRCSKLDR 539 Query: 845 DSYRRIMDENLC 810 ++Y++++DE LC Sbjct: 540 NTYKKVVDELLC 551 >ref|XP_007224434.1| hypothetical protein PRUPE_ppa021491mg [Prunus persica] gi|462421370|gb|EMJ25633.1| hypothetical protein PRUPE_ppa021491mg [Prunus persica] Length = 557 Score = 63.5 bits (153), Expect = 1e-07 Identities = 28/61 (45%), Positives = 41/61 (67%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEMRRRCPIPNL 846 CEDG+V MAI ++ I+L+SFS+ VKELC KG V E +++FE+M RC + ++ Sbjct: 448 CEDGNVNMAIQAFCGALDNNHIISLESFSILVKELCAKGMVLEAERIFEDMCNRCTVVDV 507 Query: 845 D 843 D Sbjct: 508 D 508 >ref|XP_007136868.1| hypothetical protein PHAVU_009G080600g [Phaseolus vulgaris] gi|561009955|gb|ESW08862.1| hypothetical protein PHAVU_009G080600g [Phaseolus vulgaris] Length = 550 Score = 59.7 bits (143), Expect = 2e-06 Identities = 28/51 (54%), Positives = 33/51 (64%) Frame = -2 Query: 1025 CEDGDVEMAIVMLHDMMEKGFTINLDSFSVFVKELCGKGKVSEVKKVFEEM 873 CEDGD EMA+ +D+M K F I D F FVK LC KGK+ E + VFE M Sbjct: 489 CEDGDEEMALKTFYDLMNKNFVIKQDIFCTFVKVLCAKGKLKEGETVFEGM 539