BLASTX nr result
ID: Sinomenium22_contig00050890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00050890 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442754.1| hypothetical protein CICLE_v10022688mg [Citr... 61 1e-07 ref|XP_002521952.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_007028444.1| VQ motif-containing protein, putative [Theob... 59 5e-07 gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] 59 9e-07 ref|XP_002521951.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_002322621.1| hypothetical protein POPTR_0016s03600g [Popu... 57 3e-06 ref|XP_006370978.1| hypothetical protein POPTR_0019s02310g [Popu... 56 5e-06 ref|XP_006370975.1| hypothetical protein POPTR_0019s02290g [Popu... 56 5e-06 ref|XP_006377608.1| hypothetical protein POPTR_0011s08310g [Popu... 55 8e-06 ref|XP_002322895.1| hypothetical protein POPTR_0016s09710g [Popu... 55 8e-06 ref|XP_002305274.1| hypothetical protein POPTR_0004s06890g [Popu... 55 8e-06 >ref|XP_006442754.1| hypothetical protein CICLE_v10022688mg [Citrus clementina] gi|557545016|gb|ESR55994.1| hypothetical protein CICLE_v10022688mg [Citrus clementina] Length = 150 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/82 (39%), Positives = 50/82 (60%) Frame = -3 Query: 450 SQLLGRKSKNRRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLADDDHGSISYGMG 271 SQ G + PLKV +IS+P+KV+A++ASEFRA+VQELTGK+S + D + + Sbjct: 16 SQRSGANKGKKNPLKVTYISSPMKVKASNASEFRAIVQELTGKNSEVKDHNSDDAVFPHA 75 Query: 270 SNLEKLTXXXXXXHQTKKATTY 205 + + + H+ K+ +TY Sbjct: 76 EDAKVFSHNHESDHRLKRTSTY 97 >ref|XP_002521952.1| conserved hypothetical protein [Ricinus communis] gi|223538756|gb|EEF40356.1| conserved hypothetical protein [Ricinus communis] Length = 136 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = -3 Query: 429 SKNRR-PLKVVHISNPVKVRATSASEFRALVQELTGKDSTLADDDHGSIS 283 SKNR+ P+K+ +IS+P VRA +ASEFRA+VQELTGKDS + D+ SI+ Sbjct: 23 SKNRKKPIKITYISSPTMVRAANASEFRAIVQELTGKDSKVLDNWESSIN 72 >ref|XP_007028444.1| VQ motif-containing protein, putative [Theobroma cacao] gi|508717049|gb|EOY08946.1| VQ motif-containing protein, putative [Theobroma cacao] Length = 154 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/44 (65%), Positives = 38/44 (86%) Frame = -3 Query: 435 RKSKNRRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLAD 304 +K N +P+KVV+ISNP+KV+ TSAS+FRALVQELTG+D+ L D Sbjct: 21 KKKNNNKPIKVVYISNPMKVK-TSASKFRALVQELTGQDAELPD 63 >gb|EXB38304.1| hypothetical protein L484_013937 [Morus notabilis] Length = 161 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -3 Query: 432 KSKNRRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLAD 304 K+K RP+KVV+ISNP+K++ TSASEFRALVQELTG+D+ D Sbjct: 24 KTKKTRPVKVVYISNPMKIK-TSASEFRALVQELTGQDAEFPD 65 >ref|XP_002521951.1| conserved hypothetical protein [Ricinus communis] gi|223538755|gb|EEF40355.1| conserved hypothetical protein [Ricinus communis] Length = 133 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/45 (62%), Positives = 38/45 (84%), Gaps = 1/45 (2%) Frame = -3 Query: 435 RKSKNRR-PLKVVHISNPVKVRATSASEFRALVQELTGKDSTLAD 304 + +KN++ P+K+ +ISNP VRAT+ASEFRA+VQELTGKDS + D Sbjct: 19 KHTKNKKKPVKITYISNPTLVRATNASEFRAIVQELTGKDSKVLD 63 >ref|XP_002322621.1| hypothetical protein POPTR_0016s03600g [Populus trichocarpa] gi|222867251|gb|EEF04382.1| hypothetical protein POPTR_0016s03600g [Populus trichocarpa] Length = 156 Score = 56.6 bits (135), Expect = 3e-06 Identities = 46/123 (37%), Positives = 59/123 (47%), Gaps = 25/123 (20%) Frame = -3 Query: 456 KGSQLLGRKSKNRRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLA-------DDD 298 KG+++ K K P+KVV+ISNP+K + SAS FRALVQELTG+DS L DDD Sbjct: 17 KGTKIAKTKKK---PMKVVYISNPMKFKI-SASGFRALVQELTGQDSELPDPTKIVDDDD 72 Query: 297 HG-SISYGMGSNLEKLTXXXXXXHQTKKATTYNQQ-----------------PQMLENSA 172 HG +Y SN K + +Q PQMLEN A Sbjct: 73 HGVGGNYRTVSNASKTVVDDHCALEVPTKDPSQEQPPARQDAPFGSFDDVFMPQMLENVA 132 Query: 171 SLL 163 ++ Sbjct: 133 GIM 135 >ref|XP_006370978.1| hypothetical protein POPTR_0019s02310g [Populus trichocarpa] gi|550316561|gb|ERP48775.1| hypothetical protein POPTR_0019s02310g [Populus trichocarpa] Length = 125 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/47 (61%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = -3 Query: 438 GRKS-KNRR-PLKVVHISNPVKVRATSASEFRALVQELTGKDSTLAD 304 G+KS KN+R P+K+ +IS+P V+AT+A+EFRA+VQELTGKDS + D Sbjct: 18 GQKSTKNKREPIKIKYISSPTMVKATNATEFRAIVQELTGKDSKVED 64 >ref|XP_006370975.1| hypothetical protein POPTR_0019s02290g [Populus trichocarpa] gi|550316558|gb|ERP48772.1| hypothetical protein POPTR_0019s02290g [Populus trichocarpa] Length = 126 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/47 (61%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = -3 Query: 438 GRKS-KNRR-PLKVVHISNPVKVRATSASEFRALVQELTGKDSTLAD 304 G+KS KN+R P+K+ +IS+P V+AT+A+EFRA+VQELTGKDS + D Sbjct: 18 GQKSTKNKREPIKIKYISSPTMVKATNATEFRAIVQELTGKDSKVED 64 >ref|XP_006377608.1| hypothetical protein POPTR_0011s08310g [Populus trichocarpa] gi|550327945|gb|ERP55405.1| hypothetical protein POPTR_0011s08310g [Populus trichocarpa] Length = 166 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -3 Query: 420 RRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLADDDHGSISYGMGSNLE 259 + P+K+ +IS+P V+AT+ASEFRA+VQELTGKDS + D +Y M SN E Sbjct: 25 KEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVEDPFD---AYSMISNEE 75 >ref|XP_002322895.1| hypothetical protein POPTR_0016s09710g [Populus trichocarpa] gi|222867525|gb|EEF04656.1| hypothetical protein POPTR_0016s09710g [Populus trichocarpa] Length = 138 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -3 Query: 420 RRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLADDDHGSISYGMGSNLE 259 + P+K+ +IS+P V+AT+ASEFRA+VQELTGKDS + D +Y M SN E Sbjct: 25 KEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVEDPFD---AYSMISNEE 75 >ref|XP_002305274.1| hypothetical protein POPTR_0004s06890g [Populus trichocarpa] gi|222848238|gb|EEE85785.1| hypothetical protein POPTR_0004s06890g [Populus trichocarpa] Length = 131 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = -3 Query: 420 RRPLKVVHISNPVKVRATSASEFRALVQELTGKDSTLADDDHGSISYGMGSNLE 259 + P+K+ +IS+P V+AT+ASEFRA+VQELTGKDS + D +Y M SN E Sbjct: 25 KEPVKITYISSPTMVKATNASEFRAIVQELTGKDSKVEDPFD---AYSMISNEE 75