BLASTX nr result
ID: Sinomenium22_contig00049420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049420 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC94802.1| hypothetical protein BAUCODRAFT_25915 [Baudoinia ... 55 8e-06 >gb|EMC94802.1| hypothetical protein BAUCODRAFT_25915 [Baudoinia compniacensis UAMH 10762] Length = 421 Score = 55.5 bits (132), Expect = 8e-06 Identities = 41/99 (41%), Positives = 56/99 (56%), Gaps = 17/99 (17%) Frame = +3 Query: 132 GRPLYSPSMHAMPR-----SASEIXXXXXYDTYSAYSTSSVPMSAPAIS--PAHSQ---- 278 GRP++SPS++++ R +A E Y+ +T S MSAP + PA S Sbjct: 126 GRPIFSPSLNSLVRGNSSPTAGEGLPPPPYELPHYQTTMS--MSAPPLQTLPAQSHMVGN 183 Query: 279 ----GQV-MHASILTQTPVSAHDAF-RPPPTPGYHSGSQ 377 GQ + AS+ +PVSAH+AF RPPPTP Y+SGSQ Sbjct: 184 GMMGGQTPVSASVTQPSPVSAHEAFSRPPPTPTYYSGSQ 222