BLASTX nr result
ID: Sinomenium22_contig00049274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049274 (578 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854269.1| hypothetical protein AMTR_s00039p00057090 [A... 57 5e-06 ref|XP_007034439.1| Ankyrin repeat-containing protein isoform 1 ... 56 8e-06 >ref|XP_006854269.1| hypothetical protein AMTR_s00039p00057090 [Amborella trichopoda] gi|548857945|gb|ERN15736.1| hypothetical protein AMTR_s00039p00057090 [Amborella trichopoda] Length = 666 Score = 56.6 bits (135), Expect = 5e-06 Identities = 36/80 (45%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = -2 Query: 577 ELQQLDEFCTPPSSPPPED--SYKAXXXXXXXXXXXXXXXIKTPYHRHSSSAASYPIDAV 404 ELQ L+EFCTPPSSP P ++ IK PY R SS + P V Sbjct: 568 ELQPLEEFCTPPSSPLPGRLVGRESPSISANYSNGSWFQWIKVPY-RQGSSGINSPSSRV 626 Query: 403 EDKGGDPFTLPPDYTWTTFE 344 ED DPF +P DYTWTT E Sbjct: 627 EDI-QDPFAIPSDYTWTTME 645 >ref|XP_007034439.1| Ankyrin repeat-containing protein isoform 1 [Theobroma cacao] gi|590657020|ref|XP_007034440.1| Ankyrin repeat-containing protein isoform 1 [Theobroma cacao] gi|508713468|gb|EOY05365.1| Ankyrin repeat-containing protein isoform 1 [Theobroma cacao] gi|508713469|gb|EOY05366.1| Ankyrin repeat-containing protein isoform 1 [Theobroma cacao] Length = 649 Score = 55.8 bits (133), Expect = 8e-06 Identities = 34/78 (43%), Positives = 40/78 (51%) Frame = -2 Query: 577 ELQQLDEFCTPPSSPPPEDSYKAXXXXXXXXXXXXXXXIKTPYHRHSSSAASYPIDAVED 398 ELQ +DEF TPPSSP A K PYHR SSS +Y + +E+ Sbjct: 558 ELQPVDEFSTPPSSPTAVQESPAVTNYSSSSWFQWI---KAPYHRPSSSTYNY--NKIEN 612 Query: 397 KGGDPFTLPPDYTWTTFE 344 DPF +PPDYTW T E Sbjct: 613 LQ-DPFAIPPDYTWITAE 629