BLASTX nr result
ID: Sinomenium22_contig00049243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049243 (429 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522536.1| hypothetical protein RCOM_1013810 [Ricinus c... 60 2e-07 >ref|XP_002522536.1| hypothetical protein RCOM_1013810 [Ricinus communis] gi|223538227|gb|EEF39836.1| hypothetical protein RCOM_1013810 [Ricinus communis] Length = 807 Score = 60.5 bits (145), Expect = 2e-07 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 1/130 (0%) Frame = -3 Query: 424 LMPSIALAKNFKSNSVGGSKPSPLEAGKKTLHITDLKVSRSIAPNNNPLNPRAQKEIKSQ 245 ++ SI N K S+ G L+AGK ++ LK+SR++ N + N ++EI S Sbjct: 568 VVSSIGSTWNSKLISLEG-----LKAGKGMPDLSSLKISRTLGVNKDQSNSVLKREISSL 622 Query: 244 WQSEGNNTMHVDAAGKMVH-AVNADKQGFSSPSMKRKKSEEPNADPLIQYPLKRITGLPN 68 SE N + A K+VH V+A+++ PS+KRK SE N + P KR++ P+ Sbjct: 623 RNSEKNMEVQGFTASKIVHPIVSAERETLPVPSLKRKTSEASNENLQQLNPRKRLSQSPS 682 Query: 67 ESRKPLEDFE 38 ESR E E Sbjct: 683 ESRNLKETSE 692