BLASTX nr result
ID: Sinomenium22_contig00049215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049215 (465 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ENH81732.1| conidiation-specific protein 6 [Colletotrichum or... 149 3e-34 ref|XP_007601880.1| conidiation protein 6 [Colletotrichum fiorin... 148 7e-34 ref|XP_001912145.1| hypothetical protein [Podospora anserina S m... 148 7e-34 ref|XP_007281499.1| conidiation-specific protein 6 [Colletotrich... 147 1e-33 gb|EFQ28982.1| conidiation protein 6 [Colletotrichum graminicola... 147 1e-33 gb|EQB55394.1| conidiation protein 6 [Colletotrichum gloeosporio... 146 3e-33 gb|EOO02891.1| putative conidiation-specific protein 6 protein [... 140 2e-31 gb|ETS82201.1| hypothetical protein PFICI_07203 [Pestalotiopsis ... 136 3e-30 ref|XP_003709019.1| hypothetical protein MGG_02246 [Magnaporthe ... 129 4e-28 ref|XP_003008824.1| conserved hypothetical protein [Verticillium... 126 3e-27 gb|EMT63370.1| Conidiation-specific protein 6 [Fusarium oxysporu... 125 5e-27 emb|CCT68431.1| probable conidiation protein 6 (con-6) [Fusarium... 125 6e-27 gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dah... 125 6e-27 gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxyspor... 124 1e-26 gb|EWZ37057.1| hypothetical protein FOZG_10925 [Fusarium oxyspor... 124 1e-26 gb|EKJ76144.1| hypothetical protein FPSE_03619 [Fusarium pseudog... 123 2e-26 gb|EWZ90279.1| hypothetical protein FOWG_07981 [Fusarium oxyspor... 122 4e-26 gb|EWY90450.1| hypothetical protein FOYG_07967 [Fusarium oxyspor... 122 5e-26 gb|EWG40649.1| hypothetical protein FVEG_02963 [Fusarium vertici... 121 9e-26 ref|XP_390428.1| hypothetical protein FG10252.1 [Fusarium gramin... 121 9e-26 >gb|ENH81732.1| conidiation-specific protein 6 [Colletotrichum orbiculare MAFF 240422] Length = 83 Score = 149 bits (377), Expect = 3e-34 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPTDAQ+AGGHKAN+NNPNTSEESKQNSK +L+NEFNGGDVPKS D+ +KNP NVAGGLK Sbjct: 1 MPTDAQVAGGHKANINNPNTSEESKQNSKTVLENEFNGGDVPKSGDNEEKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 ATLKNPNVSDEAK+SAKERL+ M Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >ref|XP_007601880.1| conidiation protein 6 [Colletotrichum fioriniae PJ7] gi|588892068|gb|EXF74480.1| conidiation protein 6 [Colletotrichum fioriniae PJ7] Length = 83 Score = 148 bits (374), Expect = 7e-34 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPT+AQIAGGHKAN+NNPNTSEESKQNSK +L+NEFNGGDVPK+ D+ +KNP NVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKQNSKKVLENEFNGGDVPKAGDNEEKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 ATLKNPNVSDEAKESAKERL+ M Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >ref|XP_001912145.1| hypothetical protein [Podospora anserina S mat+] gi|170947169|emb|CAP73974.1| unnamed protein product [Podospora anserina S mat+] Length = 83 Score = 148 bits (374), Expect = 7e-34 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPTDAQIAGGHKANLNNPNTS+ESK NS+ ILDNEFNGGDVPK++D+ DKNP NVAGGLK Sbjct: 1 MPTDAQIAGGHKANLNNPNTSKESKDNSQKILDNEFNGGDVPKASDTKDKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 AT+KNPNVSDEAK+SA+ERLN M Sbjct: 61 ATMKNPNVSDEAKKSAEERLNNM 83 >ref|XP_007281499.1| conidiation-specific protein 6 [Colletotrichum gloeosporioides Nara gc5] gi|429854429|gb|ELA29444.1| conidiation-specific protein 6 [Colletotrichum gloeosporioides Nara gc5] Length = 83 Score = 147 bits (372), Expect = 1e-33 Identities = 70/83 (84%), Positives = 78/83 (93%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPT+AQIAGGHKAN+NNPNTSEESK+NSK +L+NEFNGGDVPKS D+ DKNP NVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKSGDNEDKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 ATLKNPNVSDEAK+SAKERL+ M Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >gb|EFQ28982.1| conidiation protein 6 [Colletotrichum graminicola M1.001] Length = 83 Score = 147 bits (371), Expect = 1e-33 Identities = 70/83 (84%), Positives = 77/83 (92%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPT+AQIAGGHKAN+NNPNTSEESK+NSK IL+NEFNGGDVPK+ D+ KNP NVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKENSKKILENEFNGGDVPKAGDNDQKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 ATLKNPNVSDEAKESAKERL+ M Sbjct: 61 ATLKNPNVSDEAKESAKERLDNM 83 >gb|EQB55394.1| conidiation protein 6 [Colletotrichum gloeosporioides Cg-14] Length = 83 Score = 146 bits (369), Expect = 3e-33 Identities = 69/83 (83%), Positives = 78/83 (93%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPT+AQIAGGHKAN+NNPNTSEESK+NSK +L+NEFNGGDVPK+ D+ DKNP NVAGGLK Sbjct: 1 MPTEAQIAGGHKANINNPNTSEESKKNSKAVLENEFNGGDVPKAGDNEDKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 ATLKNPNVSDEAK+SAKERL+ M Sbjct: 61 ATLKNPNVSDEAKQSAKERLDNM 83 >gb|EOO02891.1| putative conidiation-specific protein 6 protein [Togninia minima UCRPA7] Length = 83 Score = 140 bits (352), Expect = 2e-31 Identities = 64/81 (79%), Positives = 78/81 (96%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQIAGGHKANLNNP+TS+ESK++SK +L++++NGGDVP+STDSGDKNP NVAGGLKAT Sbjct: 2 TDAQIAGGHKANLNNPHTSDESKEHSKKVLESDYNGGDVPRSTDSGDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQM 313 LKNP VSDEAK++A+ERL+QM Sbjct: 62 LKNPKVSDEAKQAAQERLDQM 82 >gb|ETS82201.1| hypothetical protein PFICI_07203 [Pestalotiopsis fici W106-1] Length = 84 Score = 136 bits (342), Expect = 3e-30 Identities = 63/83 (75%), Positives = 76/83 (91%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLK 244 MPT+AQIAGGHKANL N N+SEESKQ+S+ +L++EFNGGDVPK++D G+KNP NVAGGLK Sbjct: 1 MPTEAQIAGGHKANLKNANSSEESKQHSRQVLNDEFNGGDVPKASDGGNKNPGNVAGGLK 60 Query: 245 ATLKNPNVSDEAKESAKERLNQM 313 AT KNPNVS+EAK+SAK+RL QM Sbjct: 61 ATTKNPNVSEEAKQSAKQRLEQM 83 >ref|XP_003709019.1| hypothetical protein MGG_02246 [Magnaporthe oryzae 70-15] gi|351648548|gb|EHA56407.1| hypothetical protein MGG_02246 [Magnaporthe oryzae 70-15] gi|440474463|gb|ELQ43202.1| hypothetical protein OOU_Y34scaffold00164g12 [Magnaporthe oryzae Y34] gi|440481054|gb|ELQ61679.1| hypothetical protein OOW_P131scaffold01164g11 [Magnaporthe oryzae P131] Length = 85 Score = 129 bits (324), Expect = 4e-28 Identities = 62/82 (75%), Positives = 73/82 (89%), Gaps = 1/82 (1%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGD-KNPNNVAGGLKA 247 TDAQ+AGGHKANL NPNTSEESKQ+SK +L+ +F+GGDVPK+ +S + KNP NVAGGLKA Sbjct: 2 TDAQVAGGHKANLKNPNTSEESKQHSKKVLEEQFDGGDVPKAGESDEGKNPGNVAGGLKA 61 Query: 248 TLKNPNVSDEAKESAKERLNQM 313 +KNPNVSDEAKESAKERL +M Sbjct: 62 AIKNPNVSDEAKESAKERLEEM 83 >ref|XP_003008824.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261351970|gb|EEY14398.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 88 Score = 126 bits (317), Expect = 3e-27 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 5/88 (5%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVP-----KSTDSGDKNPNNV 229 MP+DAQ+AGGHKAN+NNPNTSEESKQ+S+++L+NEF G D P +S + +KNP NV Sbjct: 1 MPSDAQVAGGHKANINNPNTSEESKQHSRDVLNNEFGGEDAPNAASAQSANDDNKNPGNV 60 Query: 230 AGGLKATLKNPNVSDEAKESAKERLNQM 313 AGGLKATL NPNVSDEAK+SAKERL+ M Sbjct: 61 AGGLKATLNNPNVSDEAKQSAKERLDAM 88 >gb|EMT63370.1| Conidiation-specific protein 6 [Fusarium oxysporum f. sp. cubense race 4] gi|591470635|gb|EXM01939.1| hypothetical protein FOIG_07367 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 84 Score = 125 bits (315), Expect = 5e-27 Identities = 57/80 (71%), Positives = 72/80 (90%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTSEE+K++S+ +L+NEFNGG+V + D+ DKNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSEEAKEHSRQVLENEFNGGEVTGAEDNKDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKKNAKERLDK 81 >emb|CCT68431.1| probable conidiation protein 6 (con-6) [Fusarium fujikuroi IMI 58289] Length = 84 Score = 125 bits (314), Expect = 6e-27 Identities = 57/80 (71%), Positives = 71/80 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTSEE+K+NS+ +L NEFNGGDV + ++ +KNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSEEAKENSRQVLKNEFNGGDVTGAEENKEKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKQNAKERLDK 81 >gb|EGY13432.1| hypothetical protein VDAG_00114 [Verticillium dahliae VdLs.17] Length = 88 Score = 125 bits (314), Expect = 6e-27 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 5/88 (5%) Frame = +2 Query: 65 MPTDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVP-----KSTDSGDKNPNNV 229 MP+DAQ+AGGHKAN+NNPNTSEESKQ+S+++L+N+F G D P +S + +KNP NV Sbjct: 1 MPSDAQVAGGHKANINNPNTSEESKQHSRDVLNNDFGGEDAPNAASAQSANDDNKNPGNV 60 Query: 230 AGGLKATLKNPNVSDEAKESAKERLNQM 313 AGGLKATL NPNVSDEAK+SAKERL+ M Sbjct: 61 AGGLKATLNNPNVSDEAKQSAKERLDAM 88 >gb|EXA44629.1| hypothetical protein FOVG_06007 [Fusarium oxysporum f. sp. pisi HDV247] gi|590063055|gb|EXK90579.1| hypothetical protein FOQG_06812 [Fusarium oxysporum f. sp. raphani 54005] gi|591503688|gb|EXM33033.1| hypothetical protein FOTG_03154 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 84 Score = 124 bits (311), Expect = 1e-26 Identities = 57/80 (71%), Positives = 71/80 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ AGGHKA +NNPNTSEE+K++S+ +L+NEFNGG+V + D+ DKNP NVAGGLKAT Sbjct: 2 TDAQAAGGHKATINNPNTSEEAKEHSRQVLENEFNGGEVTGAEDNKDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKKNAKERLDK 81 >gb|EWZ37057.1| hypothetical protein FOZG_10925 [Fusarium oxysporum Fo47] Length = 84 Score = 124 bits (311), Expect = 1e-26 Identities = 57/80 (71%), Positives = 71/80 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTSEE+K++S+ L+NEFNGG+V + D+ DKNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSEEAKEHSRQALENEFNGGEVTGAEDNKDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKKNAKERLDK 81 >gb|EKJ76144.1| hypothetical protein FPSE_03619 [Fusarium pseudograminearum CS3096] Length = 84 Score = 123 bits (309), Expect = 2e-26 Identities = 56/80 (70%), Positives = 72/80 (90%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQIAGGHKA +NNPN SEE+K++S+ +L+NEFNGGDV + ++ +KNPNNVAGGLKAT Sbjct: 2 TDAQIAGGHKATINNPNVSEEAKEHSRQVLENEFNGGDVAGADENKEKNPNNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++A+ERL++ Sbjct: 62 LNNPNVSDEAKKNAQERLDK 81 >gb|EWZ90279.1| hypothetical protein FOWG_07981 [Fusarium oxysporum f. sp. lycopersici MN25] gi|591421388|gb|EXL56525.1| hypothetical protein FOCG_04109 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 84 Score = 122 bits (307), Expect = 4e-26 Identities = 56/80 (70%), Positives = 71/80 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTS+E+K++S+ L+NEFNGG+V + D+ DKNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSKEAKEHSRQALENEFNGGEVTGAEDNKDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKKNAKERLDK 81 >gb|EWY90450.1| hypothetical protein FOYG_07967 [Fusarium oxysporum FOSC 3-a] Length = 84 Score = 122 bits (306), Expect = 5e-26 Identities = 56/80 (70%), Positives = 70/80 (87%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTSEE+K+ S+ +L+NEF GG+V + D+ DKNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSEEAKEYSRQVLENEFKGGEVTGAEDNKDKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++AKERL++ Sbjct: 62 LNNPNVSDEAKKNAKERLDK 81 >gb|EWG40649.1| hypothetical protein FVEG_02963 [Fusarium verticillioides 7600] Length = 84 Score = 121 bits (304), Expect = 9e-26 Identities = 55/78 (70%), Positives = 69/78 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 TDAQ+AGGHKA +NNPNTSEE+K+NS+ +L+NEFNGGDV + ++ +KNP NVAGGLKAT Sbjct: 2 TDAQVAGGHKATINNPNTSEEAKENSRQVLENEFNGGDVTGAENNKEKNPGNVAGGLKAT 61 Query: 251 LKNPNVSDEAKESAKERL 304 L NPNVS+EAK +A+ERL Sbjct: 62 LNNPNVSEEAKRNAQERL 79 >ref|XP_390428.1| hypothetical protein FG10252.1 [Fusarium graminearum PH-1] gi|558866859|gb|ESU16942.1| hypothetical protein FGSG_10252 [Fusarium graminearum PH-1] gi|596549071|gb|EYB28766.1| hypothetical protein FG05_10252 [Fusarium graminearum] Length = 84 Score = 121 bits (304), Expect = 9e-26 Identities = 55/80 (68%), Positives = 71/80 (88%) Frame = +2 Query: 71 TDAQIAGGHKANLNNPNTSEESKQNSKNILDNEFNGGDVPKSTDSGDKNPNNVAGGLKAT 250 +DAQIAGGHKA +NNPN SEE+K++S+ +L+NEFNGGDV + D+ +KNPNNVAGGLKA Sbjct: 2 SDAQIAGGHKATINNPNVSEEAKEHSRQVLENEFNGGDVSGADDNKEKNPNNVAGGLKAA 61 Query: 251 LKNPNVSDEAKESAKERLNQ 310 L NPNVSDEAK++A+ERL++ Sbjct: 62 LNNPNVSDEAKKNAQERLDK 81