BLASTX nr result
ID: Sinomenium22_contig00049131
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049131 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204440.1| hypothetical protein PRUPE_ppa027027mg, part... 52 5e-06 >ref|XP_007204440.1| hypothetical protein PRUPE_ppa027027mg, partial [Prunus persica] gi|462399971|gb|EMJ05639.1| hypothetical protein PRUPE_ppa027027mg, partial [Prunus persica] Length = 140 Score = 51.6 bits (122), Expect(2) = 5e-06 Identities = 27/68 (39%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Frame = +2 Query: 29 TCCKKKKRNPLRVISPHCCILCKKGKEIVDH*FLLCPYARRIWDK-WGD*GSILASIFEC 205 TC +++ P SP+ C+LCKK E VDH FLLCP A +W K + G S+ C Sbjct: 10 TCDLVQRKRPGWYFSPNWCVLCKKDSETVDHLFLLCPIASSLWAKLFQVAGLTWGSLATC 69 Query: 206 PKIVESCL 229 ++E+ L Sbjct: 70 SAVLEARL 77 Score = 24.3 bits (51), Expect(2) = 5e-06 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = +1 Query: 1 VAHGKINTADVLQ 39 +AHG+INT D++Q Sbjct: 3 IAHGRINTCDLVQ 15