BLASTX nr result
ID: Sinomenium22_contig00049068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00049068 (922 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] 134 7e-29 ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phas... 69 2e-09 >emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] Length = 325 Score = 134 bits (336), Expect = 7e-29 Identities = 70/81 (86%), Positives = 72/81 (88%), Gaps = 6/81 (7%) Frame = -2 Query: 921 RRLDKSLIECRLLSE------VQ*GGREAKLSEL*LADHYISRWRRKLFELPFIRFAGAA 760 RRLDKSLIECRLLSE ++ GGREAKLSEL ADHYISRWRRKLFELPFIRFAGAA Sbjct: 245 RRLDKSLIECRLLSEDFELSLIREGGREAKLSELYKADHYISRWRRKLFELPFIRFAGAA 304 Query: 759 QHIAGSQRARTTCLTLRSEGP 697 QHIAGSQRARTTCLTLRSEGP Sbjct: 305 QHIAGSQRARTTCLTLRSEGP 325 >ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] gi|561010573|gb|ESW09480.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] Length = 48 Score = 69.3 bits (168), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 638 MTPADLTLPTPGANPLAVLPPRRRTGARVEPFISGVTAVER 516 MTPADL L TPGAN L+VLPP RRTGARVEPF+ GVTAVER Sbjct: 1 MTPADLNLSTPGANLLSVLPPCRRTGARVEPFLFGVTAVER 41