BLASTX nr result
ID: Sinomenium22_contig00048711
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048711 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007017888.1| Pentatricopeptide repeat (PPR) superfamily p... 132 4e-29 emb|CBI18929.3| unnamed protein product [Vitis vinifera] 129 4e-28 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 129 4e-28 gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] 127 2e-27 ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutr... 125 5e-27 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 125 6e-27 gb|EYU24286.1| hypothetical protein MIMGU_mgv1a025107mg [Mimulus... 125 8e-27 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 124 1e-26 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 124 1e-26 ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Caps... 123 2e-26 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 123 3e-26 gb|EYU18955.1| hypothetical protein MIMGU_mgv1a022111mg [Mimulus... 122 4e-26 ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prun... 121 9e-26 ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 121 1e-25 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 119 3e-25 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 gb|EYU34908.1| hypothetical protein MIMGU_mgv1a0030961mg, partia... 119 4e-25 ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 119 6e-25 ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 >ref|XP_007017888.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508723216|gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 758 Score = 132 bits (333), Expect = 4e-29 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA + G+LNTPPGSPL +IKNLRICGDCHA+IKFISGFEGRE++VRDTNRFHHFK Sbjct: 689 GHSEKLAVAFGLLNTPPGSPLQIIKNLRICGDCHAVIKFISGFEGREIYVRDTNRFHHFK 748 Query: 181 EGSCSCGDY 207 +G CSC DY Sbjct: 749 DGVCSCRDY 757 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 129 bits (324), Expect = 4e-28 Identities = 57/69 (82%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTPPG PL VIKNLRICGDCH +IKFIS FE RE+FVRDTNRFHHFK Sbjct: 318 GHSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFK 377 Query: 181 EGSCSCGDY 207 EG+CSCGDY Sbjct: 378 EGACSCGDY 386 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 129 bits (324), Expect = 4e-28 Identities = 57/69 (82%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTPPG PL VIKNLRICGDCH +IKFIS FE RE+FVRDTNRFHHFK Sbjct: 689 GHSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSFERREIFVRDTNRFHHFK 748 Query: 181 EGSCSCGDY 207 EG+CSCGDY Sbjct: 749 EGACSCGDY 757 >gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] Length = 728 Score = 127 bits (319), Expect = 2e-27 Identities = 56/69 (81%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA + G+LNTPPGS L VIKNLRICGDCH +IKFIS FE RE+FVRDTNRFHHFK Sbjct: 659 GHSEKLAVAFGLLNTPPGSSLRVIKNLRICGDCHVVIKFISSFEQREIFVRDTNRFHHFK 718 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 719 DGHCSCGDY 727 >ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] gi|557094189|gb|ESQ34771.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] Length = 760 Score = 125 bits (315), Expect = 5e-27 Identities = 54/69 (78%), Positives = 62/69 (89%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTP G+PL VIKNLRICGDCH++IKFISG+ GRE+FVRDTNRFHHFK Sbjct: 691 GHSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISGYAGREIFVRDTNRFHHFK 750 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 751 DGICSCGDF 759 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 125 bits (314), Expect = 6e-27 Identities = 56/69 (81%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LG+LNTPPGS L VIKNLRICGDCH++IKFIS EGRE+ VRDTNRFHHFK Sbjct: 686 GHSEKLAVVLGLLNTPPGSSLRVIKNLRICGDCHSVIKFISSLEGREISVRDTNRFHHFK 745 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 746 DGVCSCGDY 754 >gb|EYU24286.1| hypothetical protein MIMGU_mgv1a025107mg [Mimulus guttatus] Length = 654 Score = 125 bits (313), Expect = 8e-27 Identities = 56/69 (81%), Positives = 60/69 (86%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA GILNT PGSPL V KNLRICGDCHA+IKFIS FE RE+FVRDTNR+HHFK Sbjct: 585 GHSEKLAVVFGILNTSPGSPLRVTKNLRICGDCHAVIKFISRFERREIFVRDTNRYHHFK 644 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 645 DGDCSCGDY 653 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 124 bits (311), Expect = 1e-26 Identities = 53/69 (76%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTP G+PL VIKNLRICGDCHA+IKFIS + GRE+F+RDTNRFHHFK Sbjct: 691 GHSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFK 750 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 751 DGICSCGDF 759 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 124 bits (311), Expect = 1e-26 Identities = 53/69 (76%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTP G+PL VIKNLRICGDCHA+IKFIS + GRE+F+RDTNRFHHFK Sbjct: 691 GHSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSYAGREIFIRDTNRFHHFK 750 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 751 DGICSCGDF 759 >ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] gi|482575552|gb|EOA39739.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] Length = 760 Score = 123 bits (309), Expect = 2e-26 Identities = 53/69 (76%), Positives = 61/69 (88%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA G+LNTP G+PL VIKNLRICGDCH++IKFIS + GRE+FVRDTNRFHHFK Sbjct: 691 GHSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISSYAGREIFVRDTNRFHHFK 750 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 751 DGICSCGDF 759 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 123 bits (308), Expect = 3e-26 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA GILNT GSP+ V KNLRICGDCHA+IKFISGFEGRE+ VRDTNR+HHFK Sbjct: 994 GHSEKLAVVFGILNTSRGSPIRVTKNLRICGDCHAVIKFISGFEGREISVRDTNRYHHFK 1053 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 1054 DGICSCGDY 1062 >gb|EYU18955.1| hypothetical protein MIMGU_mgv1a022111mg [Mimulus guttatus] Length = 654 Score = 122 bits (307), Expect = 4e-26 Identities = 55/69 (79%), Positives = 59/69 (85%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA GILN PGSPL V KNLRICGDCHA+IKFIS FE RE+FVRDTNR+HHFK Sbjct: 585 GHSEKLAVVFGILNMSPGSPLRVTKNLRICGDCHAVIKFISRFERREIFVRDTNRYHHFK 644 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 645 DGDCSCGDY 653 >ref|XP_007227203.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica] gi|462424139|gb|EMJ28402.1| hypothetical protein PRUPE_ppa019251mg [Prunus persica] Length = 654 Score = 121 bits (304), Expect = 9e-26 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LG+LN+PPGS L VIKNLRICGDCHA+IKFIS FEGRE+ VRDTN FHHFK Sbjct: 585 GHSEKLAVVLGLLNSPPGSSLRVIKNLRICGDCHAVIKFISSFEGREISVRDTNLFHHFK 644 Query: 181 EGSCSCGDY 207 +G CSC DY Sbjct: 645 DGVCSCEDY 653 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 121 bits (303), Expect = 1e-25 Identities = 54/69 (78%), Positives = 58/69 (84%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LGILNT PG+ L VIKNLRICGDCH IKFIS FEGRE++VRD NR+HHF Sbjct: 759 GHSEKLAVVLGILNTNPGTSLRVIKNLRICGDCHTFIKFISSFEGREIYVRDANRYHHFN 818 Query: 181 EGSCSCGDY 207 EG CSCGDY Sbjct: 819 EGICSCGDY 827 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 119 bits (299), Expect = 3e-25 Identities = 52/68 (76%), Positives = 60/68 (88%) Frame = +1 Query: 4 HSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFKE 183 HSEKLA +LG+++T PG+PL VIKNLRICGDCH +KFIS FEGRE+ VRDTNRFHHFK+ Sbjct: 594 HSEKLAVALGLISTSPGTPLRVIKNLRICGDCHEAMKFISCFEGREISVRDTNRFHHFKD 653 Query: 184 GSCSCGDY 207 G CSCGDY Sbjct: 654 GKCSCGDY 661 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 119 bits (299), Expect = 3e-25 Identities = 53/69 (76%), Positives = 59/69 (85%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LG+LNT PG PL VIKNLRIC DCHA+IK IS EGRE++VRDTNRFHHFK Sbjct: 679 GHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRFHHFK 738 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 739 DGVCSCGDF 747 >gb|EYU34908.1| hypothetical protein MIMGU_mgv1a0030961mg, partial [Mimulus guttatus] Length = 131 Score = 119 bits (298), Expect = 4e-25 Identities = 54/69 (78%), Positives = 58/69 (84%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA GILNT PG PL V KNLRICGDCHA+IK IS FE RE+FVRDTNR+HHFK Sbjct: 62 GHSEKLAVVFGILNTSPGWPLRVTKNLRICGDCHAVIKCISRFERREIFVRDTNRYHHFK 121 Query: 181 EGSCSCGDY 207 +G CSCGDY Sbjct: 122 DGDCSCGDY 130 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 119 bits (297), Expect = 6e-25 Identities = 55/69 (79%), Positives = 58/69 (84%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LG+LNT PG PL VIKNLRIC DCHA+IKFIS FE RE+FVRDTNRFH FK Sbjct: 655 GHSEKLAVVLGLLNTKPGFPLQVIKNLRICRDCHAVIKFISDFEKREIFVRDTNRFHQFK 714 Query: 181 EGSCSCGDY 207 G CSCGDY Sbjct: 715 GGVCSCGDY 723 >ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 601 Score = 117 bits (293), Expect = 2e-24 Identities = 52/69 (75%), Positives = 58/69 (84%) Frame = +1 Query: 1 GHSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFK 180 GHSEKLA LG+LNT PG PL VIKNLRIC DCHA+IK IS EGRE++VRDTNR HHFK Sbjct: 532 GHSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVISRLEGREIYVRDTNRLHHFK 591 Query: 181 EGSCSCGDY 207 +G CSCGD+ Sbjct: 592 DGVCSCGDF 600 >ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Brachypodium distachyon] Length = 661 Score = 117 bits (293), Expect = 2e-24 Identities = 51/68 (75%), Positives = 59/68 (86%) Frame = +1 Query: 4 HSEKLAASLGILNTPPGSPLPVIKNLRICGDCHAMIKFISGFEGREVFVRDTNRFHHFKE 183 HSEKLA +LG+++T PG+PL VIKNLRICGDCH +KFIS FE RE+ VRDTNRFHHFK+ Sbjct: 593 HSEKLAVALGLISTRPGTPLRVIKNLRICGDCHEAMKFISSFEQREISVRDTNRFHHFKD 652 Query: 184 GSCSCGDY 207 G CSCGDY Sbjct: 653 GKCSCGDY 660