BLASTX nr result
ID: Sinomenium22_contig00048414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048414 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32034.3| unnamed protein product [Vitis vinifera] 117 2e-24 ref|XP_002269101.1| PREDICTED: pentatricopeptide repeat-containi... 117 2e-24 ref|XP_007044394.1| Tetratricopeptide repeat (TPR)-like superfam... 116 3e-24 ref|XP_006357242.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-24 ref|XP_004238748.1| PREDICTED: pentatricopeptide repeat-containi... 116 4e-24 ref|XP_006483265.1| PREDICTED: pentatricopeptide repeat-containi... 115 6e-24 ref|XP_006438554.1| hypothetical protein CICLE_v10033899mg [Citr... 115 6e-24 ref|XP_003614059.1| hypothetical protein MTR_5g044260 [Medicago ... 114 1e-23 ref|XP_003530675.1| PREDICTED: pentatricopeptide repeat-containi... 114 2e-23 ref|XP_007153862.1| hypothetical protein PHAVU_003G071000g [Phas... 113 3e-23 ref|XP_004135466.1| PREDICTED: pentatricopeptide repeat-containi... 112 4e-23 ref|XP_007227186.1| hypothetical protein PRUPE_ppa019632mg [Prun... 112 5e-23 ref|XP_002459490.1| hypothetical protein SORBIDRAFT_02g005450 [S... 112 5e-23 ref|XP_002325053.2| hypothetical protein POPTR_0018s10010g [Popu... 110 2e-22 ref|XP_004955722.1| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containi... 109 5e-22 emb|CBI28420.3| unnamed protein product [Vitis vinifera] 109 5e-22 gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] 108 8e-22 gb|EMS51902.1| hypothetical protein TRIUR3_15565 [Triticum urartu] 108 8e-22 gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] 108 8e-22 >emb|CBI32034.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 117 bits (292), Expect = 2e-24 Identities = 52/63 (82%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGLLK KPGMPIRIFKNLRVCN+CH VTK+ISRVF+ EI+VRDR RFHHFK G CSC Sbjct: 531 IAFGLLKTKPGMPIRIFKNLRVCNNCHQVTKLISRVFNREIIVRDRIRFHHFKDGACSCM 590 Query: 182 DYW 190 DYW Sbjct: 591 DYW 593 >ref|XP_002269101.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Vitis vinifera] Length = 607 Score = 117 bits (292), Expect = 2e-24 Identities = 52/63 (82%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGLLK KPGMPIRIFKNLRVCN+CH VTK+ISRVF+ EI+VRDR RFHHFK G CSC Sbjct: 545 IAFGLLKTKPGMPIRIFKNLRVCNNCHQVTKLISRVFNREIIVRDRIRFHHFKDGACSCM 604 Query: 182 DYW 190 DYW Sbjct: 605 DYW 607 >ref|XP_007044394.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508708329|gb|EOY00226.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 611 Score = 116 bits (291), Expect = 3e-24 Identities = 52/63 (82%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA GLLK++PGMPIRIFKNLRVCNDCH VTK+ISR+F VEI VRDRARFHHFK G CSC Sbjct: 549 IALGLLKLQPGMPIRIFKNLRVCNDCHEVTKLISRIFKVEIFVRDRARFHHFKDGSCSCL 608 Query: 182 DYW 190 DYW Sbjct: 609 DYW 611 >ref|XP_006357242.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Solanum tuberosum] Length = 602 Score = 116 bits (290), Expect = 4e-24 Identities = 48/63 (76%), Positives = 58/63 (92%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA+GLLK+KPG P+RIFKNLR+C+DCH VTK+IS+VFDVEI+VRDR RFHHF+ G C+CK Sbjct: 540 IAYGLLKLKPGTPLRIFKNLRICSDCHNVTKLISKVFDVEIIVRDRVRFHHFRNGSCTCK 599 Query: 182 DYW 190 DYW Sbjct: 600 DYW 602 >ref|XP_004238748.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Solanum lycopersicum] Length = 602 Score = 116 bits (290), Expect = 4e-24 Identities = 48/63 (76%), Positives = 58/63 (92%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA+GLLK+KPG P+RIFKNLR+C+DCH VTK+IS+VFDVEI+VRDR RFHHF+ G C+CK Sbjct: 540 IAYGLLKLKPGTPLRIFKNLRICSDCHNVTKLISKVFDVEIIVRDRVRFHHFRNGSCTCK 599 Query: 182 DYW 190 DYW Sbjct: 600 DYW 602 >ref|XP_006483265.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Citrus sinensis] Length = 614 Score = 115 bits (288), Expect = 6e-24 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA G+L +KPGMPIR+FKNLRVC DCH VTK+ISR+F+VEI+VRDRARFHHFK G CSC Sbjct: 552 IALGILNLKPGMPIRVFKNLRVCKDCHEVTKLISRIFNVEIIVRDRARFHHFKDGSCSCM 611 Query: 182 DYW 190 DYW Sbjct: 612 DYW 614 >ref|XP_006438554.1| hypothetical protein CICLE_v10033899mg [Citrus clementina] gi|557540750|gb|ESR51794.1| hypothetical protein CICLE_v10033899mg [Citrus clementina] Length = 597 Score = 115 bits (288), Expect = 6e-24 Identities = 49/63 (77%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA G+L +KPGMPIR+FKNLRVC DCH VTK+ISR+F+VEI+VRDRARFHHFK G CSC Sbjct: 535 IALGILNLKPGMPIRVFKNLRVCKDCHEVTKLISRIFNVEIIVRDRARFHHFKDGSCSCM 594 Query: 182 DYW 190 DYW Sbjct: 595 DYW 597 >ref|XP_003614059.1| hypothetical protein MTR_5g044260 [Medicago truncatula] gi|355515394|gb|AES97017.1| hypothetical protein MTR_5g044260 [Medicago truncatula] Length = 565 Score = 114 bits (286), Expect = 1e-23 Identities = 49/63 (77%), Positives = 55/63 (87%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGLL KP MPIR+FKNLRVCNDCH VTK+ISR+++VEI+VRDR RFHHFK G CSC Sbjct: 503 IAFGLLNSKPSMPIRVFKNLRVCNDCHKVTKLISRIYNVEIIVRDRVRFHHFKDGSCSCM 562 Query: 182 DYW 190 DYW Sbjct: 563 DYW 565 >ref|XP_003530675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Glycine max] Length = 611 Score = 114 bits (284), Expect = 2e-23 Identities = 48/63 (76%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFG+L KP +PIR+FKNLRVCNDCH VTK+ISR+++VEI+VRDRARFHHFK G CSC Sbjct: 549 IAFGILNSKPDVPIRVFKNLRVCNDCHRVTKLISRIYNVEIIVRDRARFHHFKDGTCSCM 608 Query: 182 DYW 190 DYW Sbjct: 609 DYW 611 >ref|XP_007153862.1| hypothetical protein PHAVU_003G071000g [Phaseolus vulgaris] gi|561027216|gb|ESW25856.1| hypothetical protein PHAVU_003G071000g [Phaseolus vulgaris] Length = 610 Score = 113 bits (282), Expect = 3e-23 Identities = 47/63 (74%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFG+L +PGM +R+FKNLRVCNDCH VTK+ISR+++VEI+VRDRARFHHFK G CSC Sbjct: 548 IAFGILNSRPGMAVRVFKNLRVCNDCHRVTKLISRIYNVEIIVRDRARFHHFKDGSCSCM 607 Query: 182 DYW 190 DYW Sbjct: 608 DYW 610 >ref|XP_004135466.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cucumis sativus] Length = 605 Score = 112 bits (281), Expect = 4e-23 Identities = 47/63 (74%), Positives = 56/63 (88%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGLL +KPG P+RIFKNLRVCNDCH VTK+IS +F+VEI++RDR RFHHFK G+CSC Sbjct: 543 IAFGLLNLKPGTPVRIFKNLRVCNDCHQVTKLISEIFNVEIIMRDRNRFHHFKHGMCSCM 602 Query: 182 DYW 190 D+W Sbjct: 603 DFW 605 >ref|XP_007227186.1| hypothetical protein PRUPE_ppa019632mg [Prunus persica] gi|462424122|gb|EMJ28385.1| hypothetical protein PRUPE_ppa019632mg [Prunus persica] Length = 579 Score = 112 bits (280), Expect = 5e-23 Identities = 45/63 (71%), Positives = 57/63 (90%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGLL + PG+PIRIFKNLR+CNDCH VTK+I ++F++EI++RDRARFHHF+ G+CSC Sbjct: 517 IAFGLLSLNPGVPIRIFKNLRICNDCHKVTKLICKIFNMEIIMRDRARFHHFRDGICSCM 576 Query: 182 DYW 190 DYW Sbjct: 577 DYW 579 >ref|XP_002459490.1| hypothetical protein SORBIDRAFT_02g005450 [Sorghum bicolor] gi|241922867|gb|EER96011.1| hypothetical protein SORBIDRAFT_02g005450 [Sorghum bicolor] Length = 395 Score = 112 bits (280), Expect = 5e-23 Identities = 47/63 (74%), Positives = 55/63 (87%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 I+FGLL V PG PIRI KNLRVC DCH ++K+IS+++DVEI+VRDR RFHHFKGG CSCK Sbjct: 333 ISFGLLNVTPGAPIRILKNLRVCKDCHTISKLISKLYDVEIIVRDRIRFHHFKGGSCSCK 392 Query: 182 DYW 190 DYW Sbjct: 393 DYW 395 >ref|XP_002325053.2| hypothetical protein POPTR_0018s10010g [Populus trichocarpa] gi|550318436|gb|EEF03618.2| hypothetical protein POPTR_0018s10010g [Populus trichocarpa] Length = 595 Score = 110 bits (276), Expect = 2e-22 Identities = 48/63 (76%), Positives = 54/63 (85%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IA GLL +KPGMPIRIFKNLRVC+DCH VT +IS +F+VEI+VRDR RFHHFK G CSC Sbjct: 533 IALGLLNLKPGMPIRIFKNLRVCDDCHKVTGLISEIFNVEIIVRDRVRFHHFKDGSCSCM 592 Query: 182 DYW 190 DYW Sbjct: 593 DYW 595 >ref|XP_004955722.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Setaria italica] Length = 562 Score = 109 bits (272), Expect = 5e-22 Identities = 45/63 (71%), Positives = 54/63 (85%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 I+FGLL +PG PIRI KNLRVC DCH ++K+IS+++DVEI+VRDR RFHHFK G CSCK Sbjct: 500 ISFGLLNARPGAPIRILKNLRVCKDCHTISKLISKLYDVEIIVRDRIRFHHFKDGSCSCK 559 Query: 182 DYW 190 DYW Sbjct: 560 DYW 562 >ref|XP_003633340.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Vitis vinifera] Length = 679 Score = 109 bits (272), Expect = 5e-22 Identities = 45/63 (71%), Positives = 54/63 (85%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGL+ VKPG+PIRI KNLRVCNDCH+VTK++S+++ EI+VRD RFHHFK G CSC Sbjct: 617 IAFGLINVKPGIPIRIMKNLRVCNDCHSVTKLLSKIYSREIIVRDNCRFHHFKNGSCSCM 676 Query: 182 DYW 190 DYW Sbjct: 677 DYW 679 >emb|CBI28420.3| unnamed protein product [Vitis vinifera] Length = 631 Score = 109 bits (272), Expect = 5e-22 Identities = 45/63 (71%), Positives = 54/63 (85%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAFGL+ VKPG+PIRI KNLRVCNDCH+VTK++S+++ EI+VRD RFHHFK G CSC Sbjct: 569 IAFGLINVKPGIPIRIMKNLRVCNDCHSVTKLLSKIYSREIIVRDNCRFHHFKNGSCSCM 628 Query: 182 DYW 190 DYW Sbjct: 629 DYW 631 >gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] Length = 596 Score = 108 bits (270), Expect = 8e-22 Identities = 48/63 (76%), Positives = 53/63 (84%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAF LLK PG PIRI KNLRVC DCH V K+IS+V+D EI+VRDR+RFHHFKGG CSCK Sbjct: 534 IAFALLKCLPGTPIRIVKNLRVCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCK 593 Query: 182 DYW 190 DYW Sbjct: 594 DYW 596 >gb|EMS51902.1| hypothetical protein TRIUR3_15565 [Triticum urartu] Length = 382 Score = 108 bits (270), Expect = 8e-22 Identities = 46/63 (73%), Positives = 52/63 (82%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 I+FGLLK PG PIRI KNLRVC DCH +TK+IS ++ VEI+VRDR RFHHFK G CSCK Sbjct: 254 ISFGLLKATPGAPIRILKNLRVCKDCHTITKLISELYGVEIIVRDRIRFHHFKDGACSCK 313 Query: 182 DYW 190 DYW Sbjct: 314 DYW 316 >gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] Length = 402 Score = 108 bits (270), Expect = 8e-22 Identities = 48/63 (76%), Positives = 53/63 (84%) Frame = +2 Query: 2 IAFGLLKVKPGMPIRIFKNLRVCNDCHAVTKVISRVFDVEIVVRDRARFHHFKGGLCSCK 181 IAF LLK PG PIRI KNLRVC DCH V K+IS+V+D EI+VRDR+RFHHFKGG CSCK Sbjct: 340 IAFALLKCLPGTPIRIVKNLRVCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCK 399 Query: 182 DYW 190 DYW Sbjct: 400 DYW 402