BLASTX nr result
ID: Sinomenium22_contig00048181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048181 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82518.1| hypothetical protein VITISV_042699 [Vitis vinifera] 40 6e-06 >emb|CAN82518.1| hypothetical protein VITISV_042699 [Vitis vinifera] Length = 797 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 20/39 (51%), Positives = 25/39 (64%) Frame = +1 Query: 259 GDFKVLAYINSD*ASSFFVR*STSGCYTFVGGNMATCRS 375 G ++ Y N+D A S R STSG Y+FVGGN+ T RS Sbjct: 635 GHLQIETYTNADWAGSIVDRRSTSGYYSFVGGNLVTWRS 673 Score = 35.0 bits (79), Expect(2) = 6e-06 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = +2 Query: 380 SRVEAEF*AMTHRICEVIWIRALL 451 S EAEF A+ H ICE++WIR LL Sbjct: 682 SSAEAEFRAVAHGICEIMWIRRLL 705