BLASTX nr result
ID: Sinomenium22_contig00048110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048110 (464 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836148.1| hypothetical chloroplast RF1 [Megaleranthis ... 42 8e-06 >ref|YP_002836148.1| hypothetical chloroplast RF1 [Megaleranthis saniculifolia] gi|226933940|gb|ACO92073.1| hypothetical chloroplast RF1 [Megaleranthis saniculifolia] Length = 1774 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +2 Query: 53 YRYDLLSHKHMNHADIRIKDSNLYGSPLQRNEVR 154 Y+YDLLS+K++N+ D K S++YGSP Q NEVR Sbjct: 1329 YKYDLLSNKYINYED--KKGSDIYGSPFQVNEVR 1360 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 162 YDYNTYKPDFFYAPGDV 212 Y+YNTY +FFY PGD+ Sbjct: 1369 YNYNTYNTEFFYLPGDI 1385