BLASTX nr result
ID: Sinomenium22_contig00048063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048063 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of o... 69 7e-10 ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein o... 68 1e-09 emb|CBI17609.3| unnamed protein product [Vitis vinifera] 68 1e-09 emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera] 68 1e-09 gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha cur... 68 1e-09 ref|XP_006400177.1| hypothetical protein EUTSA_v10014313mg [Eutr... 67 3e-09 gb|AEI16462.1| chloroplast acetyl-CoA carboxylase biotin-contain... 67 3e-09 gb|AEI16459.1| chloroplast acetyl-CoA carboxylase biotin-contain... 67 3e-09 gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypiu... 67 3e-09 gb|AEI16458.1| chloroplast acetyl-CoA carboxylase biotin-contain... 66 4e-09 ref|XP_006837052.1| hypothetical protein AMTR_s00110p00065160 [A... 66 6e-09 ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-Co... 66 6e-09 gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus... 65 1e-08 ref|XP_006847487.1| hypothetical protein AMTR_s00163p00066960 [A... 65 1e-08 ref|XP_006480445.1| PREDICTED: biotin carboxyl carrier protein o... 64 2e-08 ref|XP_006428626.1| hypothetical protein CICLE_v10012287mg [Citr... 64 2e-08 ref|XP_006428625.1| hypothetical protein CICLE_v10012287mg [Citr... 64 2e-08 ref|XP_002305399.1| hypothetical protein POPTR_0004s11800g [Popu... 64 2e-08 ref|XP_006384298.1| hypothetical protein POPTR_0004s11800g [Popu... 64 2e-08 ref|XP_002325474.2| hypothetical protein POPTR_0019s08170g, part... 64 2e-08 >ref|XP_002514825.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] gi|223545876|gb|EEF47379.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1) [Ricinus communis] Length = 315 Score = 68.9 bits (167), Expect = 7e-10 Identities = 38/45 (84%), Positives = 39/45 (86%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 VA LVKLVDSRDI+ELQLKQ DCELIIRKKEALPQ APVVMM Sbjct: 145 VASLVKLVDSRDIVELQLKQLDCELIIRKKEALPQPPSPAPVVMM 189 >ref|XP_002276955.2| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Vitis vinifera] Length = 286 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 VA LVKLVDSRDI+ELQ+KQ DCELIIRKKEALPQ APVVMM Sbjct: 121 VASLVKLVDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMM 165 >emb|CBI17609.3| unnamed protein product [Vitis vinifera] Length = 280 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 VA LVKLVDSRDI+ELQ+KQ DCELIIRKKEALPQ APVVMM Sbjct: 115 VASLVKLVDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMM 159 >emb|CAN80851.1| hypothetical protein VITISV_040144 [Vitis vinifera] Length = 383 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 VA LVKLVDSRDI+ELQ+KQ DCELIIRKKEALPQ APVVMM Sbjct: 191 VASLVKLVDSRDIVELQMKQLDCELIIRKKEALPQPPSAAPVVMM 235 >gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] Length = 285 Score = 67.8 bits (164), Expect = 1e-09 Identities = 37/45 (82%), Positives = 39/45 (86%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 VA LVKLVDSRDI+ELQLKQ DCE+IIRKKEALPQ APVVMM Sbjct: 118 VASLVKLVDSRDIVELQLKQLDCEVIIRKKEALPQPPSPAPVVMM 162 >ref|XP_006400177.1| hypothetical protein EUTSA_v10014313mg [Eutrema salsugineum] gi|557101267|gb|ESQ41630.1| hypothetical protein EUTSA_v10014313mg [Eutrema salsugineum] Length = 283 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMMQ 126 V LVKLVDSRDI+ELQLKQ DCEL+IRKKEALPQ AP VMMQ Sbjct: 119 VTTLVKLVDSRDIVELQLKQLDCELVIRKKEALPQPQSPAPYVMMQ 164 >gb|AEI16462.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit [Brassica napus] Length = 274 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMMQ 126 V LVKLVDSRDI+ELQLKQ DCEL+IRKKEALPQ AP VMMQ Sbjct: 114 VTTLVKLVDSRDIVELQLKQLDCELVIRKKEALPQAQTPAPYVMMQ 159 >gb|AEI16459.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit [Brassica rapa] Length = 276 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMMQ 126 V LVKLVDSRDI+ELQLKQ DCEL+IRKKEALPQ AP VMMQ Sbjct: 114 VTTLVKLVDSRDIVELQLKQLDCELVIRKKEALPQPQSPAPYVMMQ 159 >gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] Length = 282 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/46 (78%), Positives = 39/46 (84%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMMQ 126 V+ LVKLVDSR I+ELQLKQ DCEL+IRKKEALPQ APVVMMQ Sbjct: 118 VSSLVKLVDSRGIVELQLKQLDCELVIRKKEALPQPPSAAPVVMMQ 163 >gb|AEI16458.1| chloroplast acetyl-CoA carboxylase biotin-containing subunit [Brassica oleracea] Length = 281 Score = 66.2 bits (160), Expect = 4e-09 Identities = 36/47 (76%), Positives = 38/47 (80%), Gaps = 5/47 (10%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ-----APVVMMQ 126 V LVKLVDSRDI+ELQLKQ DCEL+IRKKEALPQ AP VMMQ Sbjct: 114 VTTLVKLVDSRDIVELQLKQLDCELVIRKKEALPQPPQSPAPYVMMQ 160 >ref|XP_006837052.1| hypothetical protein AMTR_s00110p00065160 [Amborella trichopoda] gi|548839645|gb|ERM99905.1| hypothetical protein AMTR_s00110p00065160 [Amborella trichopoda] Length = 278 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ---APVVMMQH 129 VA LVKLVDSRDIMELQ+KQ DCEL IRKKEALPQ AP +M H Sbjct: 116 VANLVKLVDSRDIMELQMKQLDCELTIRKKEALPQPPPAPAPVMMH 161 >ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] gi|508711730|gb|EOY03627.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] Length = 288 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 4/47 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEAL----PQAPVVMMQH 129 V++LVKLVDSRDI ELQLKQSDCEL+IRKKEAL P +P+VM Q+ Sbjct: 122 VSDLVKLVDSRDITELQLKQSDCELVIRKKEALQLPEPASPIVMPQY 168 >gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus guttatus] Length = 270 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQAPV 114 V +LVKLVDSRDI+EL+LKQ DCEL+IRKKEALPQ PV Sbjct: 106 VTDLVKLVDSRDIVELELKQMDCELLIRKKEALPQPPV 143 >ref|XP_006847487.1| hypothetical protein AMTR_s00163p00066960 [Amborella trichopoda] gi|548850720|gb|ERN09068.1| hypothetical protein AMTR_s00163p00066960 [Amborella trichopoda] Length = 248 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/45 (77%), Positives = 38/45 (84%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQ----APVVMM 123 V+ LVKLVDSRDI+ELQL+Q DCEL IRKKEALPQ APVVMM Sbjct: 107 VSSLVKLVDSRDIVELQLQQHDCELTIRKKEALPQPPAPAPVVMM 151 >ref|XP_006480445.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Citrus sinensis] Length = 285 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQAP 111 V+ L+KLVDSRDI+ELQLKQ DCELIIRKKEALPQ P Sbjct: 118 VSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQPP 154 >ref|XP_006428626.1| hypothetical protein CICLE_v10012287mg [Citrus clementina] gi|568853611|ref|XP_006480444.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Citrus sinensis] gi|557530683|gb|ESR41866.1| hypothetical protein CICLE_v10012287mg [Citrus clementina] Length = 308 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQAP 111 V+ L+KLVDSRDI+ELQLKQ DCELIIRKKEALPQ P Sbjct: 141 VSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQPP 177 >ref|XP_006428625.1| hypothetical protein CICLE_v10012287mg [Citrus clementina] gi|568853615|ref|XP_006480446.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X3 [Citrus sinensis] gi|557530682|gb|ESR41865.1| hypothetical protein CICLE_v10012287mg [Citrus clementina] Length = 277 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALPQAP 111 V+ L+KLVDSRDI+ELQLKQ DCELIIRKKEALPQ P Sbjct: 110 VSSLIKLVDSRDIVELQLKQLDCELIIRKKEALPQPP 146 >ref|XP_002305399.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa] gi|222848363|gb|EEE85910.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa] Length = 281 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEAL----PQAPVVMMQ 126 V+ELVKLVDSRDI ELQLKQS CELIIRKKEAL P APV+ MQ Sbjct: 119 VSELVKLVDSRDITELQLKQSGCELIIRKKEALQQSEPAAPVLPMQ 164 >ref|XP_006384298.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa] gi|118483512|gb|ABK93654.1| unknown [Populus trichocarpa] gi|550340855|gb|ERP62095.1| hypothetical protein POPTR_0004s11800g [Populus trichocarpa] Length = 251 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/46 (78%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEAL----PQAPVVMMQ 126 V+ELVKLVDSRDI ELQLKQS CELIIRKKEAL P APV+ MQ Sbjct: 89 VSELVKLVDSRDITELQLKQSGCELIIRKKEALQQSEPAAPVLPMQ 134 >ref|XP_002325474.2| hypothetical protein POPTR_0019s08170g, partial [Populus trichocarpa] gi|550317001|gb|EEE99855.2| hypothetical protein POPTR_0019s08170g, partial [Populus trichocarpa] Length = 286 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/45 (75%), Positives = 38/45 (84%), Gaps = 4/45 (8%) Frame = +1 Query: 1 VAELVKLVDSRDIMELQLKQSDCELIIRKKEALP----QAPVVMM 123 V+ LVKLVDSRDI+ELQLKQ DCEL+IRKKEALP +PVVMM Sbjct: 147 VSSLVKLVDSRDIVELQLKQLDCELLIRKKEALPLPPSHSPVVMM 191