BLASTX nr result
ID: Sinomenium22_contig00048048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00048048 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17281.3| unnamed protein product [Vitis vinifera] 108 1e-21 ref|XP_002264012.1| PREDICTED: U3 small nucleolar RNA-associated... 108 1e-21 ref|XP_007034248.1| ARM repeat superfamily protein, putative [Th... 106 4e-21 gb|EXC21919.1| hypothetical protein L484_011084 [Morus notabilis] 103 3e-20 ref|XP_006421008.1| hypothetical protein CICLE_v10004117mg [Citr... 102 7e-20 ref|XP_006489855.1| PREDICTED: small subunit processome componen... 99 5e-19 ref|XP_006489854.1| PREDICTED: small subunit processome componen... 99 5e-19 ref|XP_007216149.1| hypothetical protein PRUPE_ppa015122mg [Prun... 99 5e-19 ref|XP_007163660.1| hypothetical protein PHAVU_001G253000g, part... 99 6e-19 ref|XP_003601650.1| Small subunit processome component-like prot... 99 6e-19 ref|XP_004139015.1| PREDICTED: small subunit processome componen... 98 1e-18 ref|XP_007214892.1| hypothetical protein PRUPE_ppa000015mg [Prun... 96 5e-18 ref|XP_006601933.1| PREDICTED: small subunit processome componen... 94 2e-17 ref|XP_002518041.1| conserved hypothetical protein [Ricinus comm... 94 3e-17 ref|XP_004305310.1| PREDICTED: small subunit processome componen... 92 6e-17 ref|XP_006360968.1| PREDICTED: small subunit processome componen... 91 1e-16 ref|XP_004247966.1| PREDICTED: small subunit processome componen... 91 1e-16 ref|XP_006412644.1| hypothetical protein EUTSA_v10024182mg [Eutr... 90 3e-16 gb|EPS64445.1| hypothetical protein M569_10337, partial [Genlise... 90 3e-16 ref|XP_004492742.1| PREDICTED: small subunit processome componen... 90 3e-16 >emb|CBI17281.3| unnamed protein product [Vitis vinifera] Length = 2629 Score = 108 bits (269), Expect = 1e-21 Identities = 51/64 (79%), Positives = 58/64 (90%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT H+Q+VKSLNKS+GR RFVFK FSQRLEEIEI+VFRSLDPLK EPS+GSSF R+CL Sbjct: 1 MATSFHAQAVKSLNKSSGRKRFVFKNFSQRLEEIEIDVFRSLDPLKTEPSEGSSFFRDCL 60 Query: 308 LQWR 319 +QWR Sbjct: 61 VQWR 64 >ref|XP_002264012.1| PREDICTED: U3 small nucleolar RNA-associated protein 20-like [Vitis vinifera] Length = 224 Score = 108 bits (269), Expect = 1e-21 Identities = 51/64 (79%), Positives = 58/64 (90%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT H+Q+VKSLNKS+GR RFVFK FSQRLEEIEI+VFRSLDPLK EPS+GSSF R+CL Sbjct: 1 MATSFHAQAVKSLNKSSGRKRFVFKNFSQRLEEIEIDVFRSLDPLKTEPSEGSSFFRDCL 60 Query: 308 LQWR 319 +QWR Sbjct: 61 VQWR 64 >ref|XP_007034248.1| ARM repeat superfamily protein, putative [Theobroma cacao] gi|508713277|gb|EOY05174.1| ARM repeat superfamily protein, putative [Theobroma cacao] Length = 2725 Score = 106 bits (264), Expect = 4e-21 Identities = 49/64 (76%), Positives = 59/64 (92%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATPSH+Q+VKSLNKS GR RFVFK FSQR+E+I+INVFRSLD +K+EPS+GSSFLR+CL Sbjct: 1 MATPSHAQAVKSLNKSPGRRRFVFKTFSQRIEDIDINVFRSLDKIKSEPSEGSSFLRDCL 60 Query: 308 LQWR 319 +WR Sbjct: 61 NEWR 64 >gb|EXC21919.1| hypothetical protein L484_011084 [Morus notabilis] Length = 412 Score = 103 bits (256), Expect = 3e-20 Identities = 46/64 (71%), Positives = 59/64 (92%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATPSH+Q+VKSLNKS+GR RFVFK FSQR+E+I+I+V+RSLD +K+EPS+GSSF R+CL Sbjct: 1 MATPSHAQAVKSLNKSSGRQRFVFKTFSQRIEDIDIDVYRSLDKVKSEPSEGSSFFRDCL 60 Query: 308 LQWR 319 +WR Sbjct: 61 AEWR 64 >ref|XP_006421008.1| hypothetical protein CICLE_v10004117mg [Citrus clementina] gi|557522881|gb|ESR34248.1| hypothetical protein CICLE_v10004117mg [Citrus clementina] Length = 2651 Score = 102 bits (253), Expect = 7e-20 Identities = 47/64 (73%), Positives = 57/64 (89%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT H+ +VKSLNKS GR RFVFK FSQ++++IEINVFRSLD +KAEPS+GSSFLR+CL Sbjct: 1 MATAEHAAAVKSLNKSPGRRRFVFKSFSQQIDDIEINVFRSLDKVKAEPSEGSSFLRDCL 60 Query: 308 LQWR 319 +QWR Sbjct: 61 IQWR 64 >ref|XP_006489855.1| PREDICTED: small subunit processome component 20 homolog isoform X2 [Citrus sinensis] Length = 2702 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT H+ +VKSLNKS GR RFVFK FSQ++++IEINVFRSLD +KAEPS+GSSF R+CL Sbjct: 1 MATAEHAAAVKSLNKSPGRRRFVFKSFSQQIDDIEINVFRSLDKVKAEPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 IEWR 64 >ref|XP_006489854.1| PREDICTED: small subunit processome component 20 homolog isoform X1 [Citrus sinensis] Length = 2703 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT H+ +VKSLNKS GR RFVFK FSQ++++IEINVFRSLD +KAEPS+GSSF R+CL Sbjct: 1 MATAEHAAAVKSLNKSPGRRRFVFKSFSQQIDDIEINVFRSLDKVKAEPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 IEWR 64 >ref|XP_007216149.1| hypothetical protein PRUPE_ppa015122mg [Prunus persica] gi|462412299|gb|EMJ17348.1| hypothetical protein PRUPE_ppa015122mg [Prunus persica] Length = 2641 Score = 99.4 bits (246), Expect = 5e-19 Identities = 45/64 (70%), Positives = 56/64 (87%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATPS +Q+VKSLNKS GR RFVFK FSQRLEE+E++VFRSLD +K+EP GS+F R+CL Sbjct: 1 MATPSQAQAVKSLNKSPGRRRFVFKSFSQRLEEVEVDVFRSLDKVKSEPQAGSTFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >ref|XP_007163660.1| hypothetical protein PHAVU_001G253000g, partial [Phaseolus vulgaris] gi|561037124|gb|ESW35654.1| hypothetical protein PHAVU_001G253000g, partial [Phaseolus vulgaris] Length = 2722 Score = 99.0 bits (245), Expect = 6e-19 Identities = 43/64 (67%), Positives = 58/64 (90%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT SH+++VKSLNKS GR RFVFK FS+R++EI++NV+RSL+ +KAEPS+GSSF R+CL Sbjct: 30 MATASHARAVKSLNKSPGRGRFVFKSFSERVDEIDVNVYRSLEKVKAEPSEGSSFFRDCL 89 Query: 308 LQWR 319 ++WR Sbjct: 90 IEWR 93 >ref|XP_003601650.1| Small subunit processome component-like protein [Medicago truncatula] gi|355490698|gb|AES71901.1| Small subunit processome component-like protein [Medicago truncatula] Length = 2733 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/64 (68%), Positives = 57/64 (89%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATP+H+Q+VKSLNKS GR RFVFK FS R+++I+INV+RSL +KAEPS+GSSF R+CL Sbjct: 1 MATPAHAQAVKSLNKSPGRRRFVFKSFSDRVDDIDINVYRSLHKVKAEPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >ref|XP_004139015.1| PREDICTED: small subunit processome component 20 homolog [Cucumis sativus] Length = 2696 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/64 (68%), Positives = 58/64 (90%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT SH+Q+VKSLNKS GR RFVF+ FSQR++EI+I+V+RSLD +K+EPS+GSSF R+CL Sbjct: 1 MATASHAQAVKSLNKSPGRRRFVFQTFSQRVQEIDIDVYRSLDKVKSEPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 IEWR 64 >ref|XP_007214892.1| hypothetical protein PRUPE_ppa000015mg [Prunus persica] gi|462411042|gb|EMJ16091.1| hypothetical protein PRUPE_ppa000015mg [Prunus persica] Length = 2663 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/64 (70%), Positives = 55/64 (85%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S +Q+VKSLNKS GR RFVFK FSQRLEE+EI+VFRSLD +K+EP GS+F R+CL Sbjct: 1 MATLSQAQAVKSLNKSPGRRRFVFKSFSQRLEEVEIDVFRSLDKVKSEPQAGSTFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >ref|XP_006601933.1| PREDICTED: small subunit processome component 20 homolog [Glycine max] Length = 2696 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S +++VKSLNKS G RFVFK FS R++EI+INV+RSLD +KAEPS+GSSF R+CL Sbjct: 1 MATASQARAVKSLNKSPGGRRFVFKSFSDRVDEIDINVYRSLDKVKAEPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 IEWR 64 >ref|XP_002518041.1| conserved hypothetical protein [Ricinus communis] gi|223542637|gb|EEF44174.1| conserved hypothetical protein [Ricinus communis] Length = 2535 Score = 93.6 bits (231), Expect = 3e-17 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT SH+Q+VKSLNKS G RFVFK SQR+ EIEI+V+RSLD +K++PS+GSSF R+CL Sbjct: 1 MATASHAQAVKSLNKSPGGRRFVFKSLSQRIVEIEIDVYRSLDKVKSQPSEGSSFFRDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >ref|XP_004305310.1| PREDICTED: small subunit processome component 20 homolog [Fragaria vesca subsp. vesca] Length = 2681 Score = 92.4 bits (228), Expect = 6e-17 Identities = 43/64 (67%), Positives = 53/64 (82%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S +Q+VKSLN S GR RFVFK SQRLEE+EI+VFRSLD +K EPS GS+F ++CL Sbjct: 1 MATSSQAQAVKSLNNSAGRRRFVFKSISQRLEEVEIDVFRSLDKVKDEPSPGSTFFKDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >ref|XP_006360968.1| PREDICTED: small subunit processome component 20 homolog [Solanum tuberosum] Length = 1461 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/64 (62%), Positives = 54/64 (84%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S +VKSLNKS GR RF FK FS+R+E+++I+V+R+LDPLKAEP++GSSF R+C+ Sbjct: 1 MATHSDMYAVKSLNKSPGRRRFTFKTFSERIEDVDIDVYRNLDPLKAEPTEGSSFFRDCI 60 Query: 308 LQWR 319 +WR Sbjct: 61 TEWR 64 >ref|XP_004247966.1| PREDICTED: small subunit processome component 20 homolog [Solanum lycopersicum] Length = 2660 Score = 91.3 bits (225), Expect = 1e-16 Identities = 40/64 (62%), Positives = 54/64 (84%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S +VKSLNKS GR RF FK FS+R+E+++I+V+R+LDPLKAEP++GSSF R+C+ Sbjct: 1 MATHSDMYAVKSLNKSPGRRRFTFKTFSERIEDVDIDVYRNLDPLKAEPTEGSSFFRDCI 60 Query: 308 LQWR 319 +WR Sbjct: 61 TEWR 64 >ref|XP_006412644.1| hypothetical protein EUTSA_v10024182mg [Eutrema salsugineum] gi|557113814|gb|ESQ54097.1| hypothetical protein EUTSA_v10024182mg [Eutrema salsugineum] Length = 2606 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/64 (65%), Positives = 54/64 (84%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATP+ +++VKSLN S GR RFVFK SQR+ +I+INVFRSLD +KAEPS+GSSF R+ L Sbjct: 1 MATPADARAVKSLNNSEGRKRFVFKTVSQRINDIDINVFRSLDKVKAEPSEGSSFFRDRL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64 >gb|EPS64445.1| hypothetical protein M569_10337, partial [Genlisea aurea] Length = 139 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/64 (67%), Positives = 55/64 (85%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MAT S S++VK LNK +GR RFVFK FSQR+EEI+I+V+RSL+ KAEPSDGSSF R+CL Sbjct: 9 MATLSESRAVKGLNKCSGRRRFVFKTFSQRIEEIDIDVYRSLNVSKAEPSDGSSFFRDCL 68 Query: 308 LQWR 319 +++R Sbjct: 69 IEYR 72 >ref|XP_004492742.1| PREDICTED: small subunit processome component 20 homolog [Cicer arietinum] Length = 2700 Score = 90.1 bits (222), Expect = 3e-16 Identities = 39/64 (60%), Positives = 55/64 (85%) Frame = +2 Query: 128 MATPSHSQSVKSLNKSTGRSRFVFKKFSQRLEEIEINVFRSLDPLKAEPSDGSSFLRECL 307 MATPSH+Q+VKSLNKS G RFVFK FS+RL++++INV+RSL+ + PS+GS+F ++CL Sbjct: 1 MATPSHAQAVKSLNKSPGGRRFVFKTFSERLDDVDINVYRSLEQVAELPSEGSTFFKDCL 60 Query: 308 LQWR 319 ++WR Sbjct: 61 VEWR 64