BLASTX nr result
ID: Sinomenium22_contig00047812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00047812 (724 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabac... 57 6e-06 >ref|NP_054501.1| hypothetical protein NitaCp025 [Nicotiana tabacum] gi|78102537|ref|YP_358678.1| hypothetical protein NisyCp031 [Nicotiana sylvestris] gi|11835|emb|CAA77355.1| hypothetical protein [Nicotiana tabacum] gi|77799564|dbj|BAE46653.1| hypothetical protein [Nicotiana sylvestris] gi|225203|prf||1211235AH ORF 70A Length = 70 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +1 Query: 133 KTKKRIDRSSIQNLSGKLRGREAYIGGMYPCILNCGYRNDRIISDLTKYG 282 K KK+ L+GK+ GRE Y G+YP ILNCG+RND+II D TK G Sbjct: 19 KIKKKNRPFKYSKLNGKMAGRETYRWGIYPSILNCGFRNDKIIFDWTKKG 68