BLASTX nr result
ID: Sinomenium22_contig00047782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00047782 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20645.1| Calmodulin-interacting protein 111 [Morus notabilis] 57 3e-06 ref|XP_006430512.1| hypothetical protein CICLE_v10013654mg [Citr... 56 6e-06 >gb|EXC20645.1| Calmodulin-interacting protein 111 [Morus notabilis] Length = 1031 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/58 (44%), Positives = 42/58 (72%) Frame = +1 Query: 157 EAELKEDDIRGLLDEAAIEYPSLISKDAFVGRLTGAESYSSSSHTAVIWLSESAMVAS 330 ++E ++++ L++A+++YPSLI K AF+G++T E + S S IWLSES+MVAS Sbjct: 34 DSETSDENLMHTLEKASVKYPSLIGKTAFIGQVTDIEQHVSKSKGYNIWLSESSMVAS 91 >ref|XP_006430512.1| hypothetical protein CICLE_v10013654mg [Citrus clementina] gi|557532569|gb|ESR43752.1| hypothetical protein CICLE_v10013654mg [Citrus clementina] Length = 1046 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = +1 Query: 172 EDDIRGLLDEAAIEYPSLISKDAFVGRLTGAESYSSSSHTAVIWLSESAMVASSI 336 E+D R L++A+ YP+LI K AF+G++TG E + S IWLSES+M+ASS+ Sbjct: 37 EEDFRSSLEDASTRYPTLIGKSAFIGQITGIE---TDSRGCKIWLSESSMLASSL 88