BLASTX nr result
ID: Sinomenium22_contig00047620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00047620 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364483.1| PREDICTED: uncharacterized protein LOC102585... 61 2e-07 >ref|XP_006364483.1| PREDICTED: uncharacterized protein LOC102585795 [Solanum tuberosum] Length = 456 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/75 (40%), Positives = 44/75 (58%), Gaps = 3/75 (4%) Frame = -3 Query: 217 RFDNVRVSEGLD---PIREEYMLERDDDGGGMAFPLGPQNGFSGDFMPSASKFWTDTTNG 47 RF V +SEG+D + E Y+ + M+ G NGF+ +++ SASKFW + + Sbjct: 195 RFGKVGISEGMDLGVGMEECYLANGIPNAEQMSGVYGQSNGFNSEYLNSASKFWAEKASP 254 Query: 46 WQDMQYDFLESQYHL 2 WQDMQYD +S +HL Sbjct: 255 WQDMQYDSADSLHHL 269