BLASTX nr result
ID: Sinomenium22_contig00047210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00047210 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280803.2| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 emb|CBI28050.3| unnamed protein product [Vitis vinifera] 58 1e-06 >ref|XP_002280803.2| PREDICTED: pentatricopeptide repeat-containing protein At2g32230, mitochondrial-like [Vitis vinifera] Length = 816 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 18 PQKLYRNLRTFMSNSVFSNHQTLLSDIEAAEKLGGCIMTFR 140 PQ++YRNLR +S S+F H T+LS+IEAAEKLG CI+ F+ Sbjct: 775 PQEIYRNLRNILSASIFPTHSTVLSEIEAAEKLGNCIIDFQ 815 >emb|CBI28050.3| unnamed protein product [Vitis vinifera] Length = 751 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +3 Query: 18 PQKLYRNLRTFMSNSVFSNHQTLLSDIEAAEKLGGCIMTFR 140 PQ++YRNLR +S S+F H T+LS+IEAAEKLG CI+ F+ Sbjct: 710 PQEIYRNLRNILSASIFPTHSTVLSEIEAAEKLGNCIIDFQ 750