BLASTX nr result
ID: Sinomenium22_contig00047155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00047155 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resista... 89 8e-16 ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [A... 67 3e-09 >ref|XP_002276895.2| PREDICTED: putative pleiotropic drug resistance protein 7-like [Vitis vinifera] Length = 1538 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 210 EQEEDYQSQWEHFQRPFIQTWWNSTKKLTNRQFRITKRLHALIKLRLFQ 356 ++E++YQSQWE FQRPF+QTWW STK L NRQ +ITKRLHALIKLRLFQ Sbjct: 572 KEEDEYQSQWEQFQRPFVQTWWKSTKTLINRQVKITKRLHALIKLRLFQ 620 >ref|XP_006841589.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] gi|548843610|gb|ERN03264.1| hypothetical protein AMTR_s00003p00199390 [Amborella trichopoda] Length = 1620 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +3 Query: 210 EQEEDYQSQWEHFQRPFIQTWWNSTKKLTNRQFRITKRLHALIKLRLFQ 356 ++E+ YQS E FQRPFIQTW STK L RQ +I ++LH LIKLRLFQ Sbjct: 629 DREDKYQSHSEQFQRPFIQTWGESTKVLIQRQMKIARQLHMLIKLRLFQ 677