BLASTX nr result
ID: Sinomenium22_contig00046996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046996 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populu... 45 5e-07 ref|XP_006401224.1| hypothetical protein EUTSA_v10012580mg [Eutr... 41 6e-06 ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containi... 42 8e-06 >ref|XP_006372189.1| cytochrome P450 71B10 family protein [Populus trichocarpa] gi|550318714|gb|ERP49986.1| cytochrome P450 71B10 family protein [Populus trichocarpa] Length = 1075 Score = 45.1 bits (105), Expect(2) = 5e-07 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = -3 Query: 164 FLSKAHKIGFLLHFFS*MTINNILVNSHTFSIVSQALLKANRFDEEARFM 15 FLSK+HK + HFF + N I N T S+ + ALLK ++F+E FM Sbjct: 35 FLSKSHKYELITHFFCQINRNKIKCNPQTHSVFTCALLKLDKFEEAEHFM 84 Score = 34.3 bits (77), Expect(2) = 5e-07 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -1 Query: 244 TSQKHSLQNLLKSGFSPTLETFHRFL 167 +S S+Q LLKSGFSPTL++ ++FL Sbjct: 8 SSSSSSVQTLLKSGFSPTLKSINQFL 33 >ref|XP_006401224.1| hypothetical protein EUTSA_v10012580mg [Eutrema salsugineum] gi|557102314|gb|ESQ42677.1| hypothetical protein EUTSA_v10012580mg [Eutrema salsugineum] Length = 971 Score = 40.8 bits (94), Expect(2) = 6e-06 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = -3 Query: 164 FLSKAHKIGFLLHFFS*MTINNILVNSHTFSIVSQALLKANRFDEEARFMS 12 +L + K +LHF+S + + VN+ +SIVS A L NR++E +F++ Sbjct: 35 YLYRRQKFNCILHFYSQLDSEKLQVNNRIYSIVSWAFLNLNRYEEAEKFIN 85 Score = 34.7 bits (78), Expect(2) = 6e-06 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = -1 Query: 229 SLQNLLKSGFSPTLETFHRFL 167 SLQ+LLKSGFSPTL + RFL Sbjct: 13 SLQSLLKSGFSPTLNSIDRFL 33 >ref|XP_006474246.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X1 [Citrus sinensis] gi|568840585|ref|XP_006474247.1| PREDICTED: pentatricopeptide repeat-containing protein At5g57250, mitochondrial-like isoform X2 [Citrus sinensis] Length = 1074 Score = 42.0 bits (97), Expect(2) = 8e-06 Identities = 20/50 (40%), Positives = 32/50 (64%) Frame = -3 Query: 164 FLSKAHKIGFLLHFFS*MTINNILVNSHTFSIVSQALLKANRFDEEARFM 15 +LS+ + F++HFFS + N+I NS T S + ALLK ++F+E F+ Sbjct: 42 WLSQNKRFNFVIHFFSQLNSNHIKPNSQTHSTFAWALLKLHKFEEAYHFL 91 Score = 33.1 bits (74), Expect(2) = 8e-06 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = -1 Query: 295 LFIPFSAETSLHQYHLKTSQKHSLQNLLKSGFSPTLETFHRFLL 164 +F+ S +S H KTS S Q L+K GF+PTL + ++FLL Sbjct: 1 MFMTRSFSSSSPCNHPKTS---SFQTLIKRGFTPTLNSINKFLL 41