BLASTX nr result
ID: Sinomenium22_contig00046941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046941 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus... 71 2e-10 ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [S... 70 2e-10 ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 69 5e-10 gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] 69 5e-10 gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] 69 7e-10 ref|XP_006439922.1| hypothetical protein CICLE_v10024603mg [Citr... 69 7e-10 gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] 69 7e-10 ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containi... 69 7e-10 emb|CBI15839.3| unnamed protein product [Vitis vinifera] 69 7e-10 gb|EXB60277.1| hypothetical protein L484_005875 [Morus notabilis] 69 9e-10 ref|XP_006410036.1| hypothetical protein EUTSA_v10016305mg [Eutr... 69 9e-10 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 emb|CBI24015.3| unnamed protein product [Vitis vinifera] 69 9e-10 emb|CBI14948.3| unnamed protein product [Vitis vinifera] 69 9e-10 >ref|XP_004975979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Setaria italica] Length = 695 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS VY+REI+VRDR RFHHF+ GSCSCNDYW Sbjct: 659 HSATKLISKVYNREIVVRDRNRFHHFKDGSCSCNDYW 695 >gb|EYU20789.1| hypothetical protein MIMGU_mgv1a002968mg [Mimulus guttatus] Length = 621 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H A+K ISMVYDREI+VRDR RFHHFR G CSCNDYW Sbjct: 585 HVASKLISMVYDREIVVRDRNRFHHFRGGLCSCNDYW 621 >ref|XP_002448053.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] gi|241939236|gb|EES12381.1| hypothetical protein SORBIDRAFT_06g020256 [Sorghum bicolor] Length = 693 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS VY+REI+VRDR RFHHF+ G+CSCNDYW Sbjct: 657 HSATKLISKVYNREIVVRDRNRFHHFKDGTCSCNDYW 693 >ref|XP_004965051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Setaria italica] Length = 601 Score = 69.7 bits (169), Expect = 4e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H ATKF+S V+DREI+VRDR RFHHFR G CSC DYW Sbjct: 565 HEATKFVSRVFDREIVVRDRNRFHHFRDGKCSCKDYW 601 >ref|XP_003581359.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like, partial [Brachypodium distachyon] Length = 745 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS VY+REI+VRDR RFHHF+ G CSCNDYW Sbjct: 709 HSATKLISKVYNREIIVRDRNRFHHFKDGLCSCNDYW 745 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATKFIS +Y+REI+VRDR RFHHF+ GSCSC D+W Sbjct: 530 HSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATKFIS +Y+REI+VRDR RFHHF+ GSCSC D+W Sbjct: 564 HSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H A+KFIS VYDREI+VRDR RFHHF+ G CSC DYW Sbjct: 592 HQASKFISKVYDREIIVRDRNRFHHFKGGECSCKDYW 628 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATKFIS +Y+REI+VRDR RFHHF+ GSCSC D+W Sbjct: 593 HSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629 >gb|AFW58607.1| hypothetical protein ZEAMMB73_481408 [Zea mays] Length = 694 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS VYDREI+VRDR FHHF+ G+CSCNDYW Sbjct: 658 HSATKLISKVYDREIVVRDRNIFHHFKDGTCSCNDYW 694 >gb|EXB86239.1| hypothetical protein L484_005950 [Morus notabilis] Length = 737 Score = 68.9 bits (167), Expect = 7e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS +++REI+ RDR RFHHF+ GSCSCNDYW Sbjct: 701 HSATKLISKIFNREIIARDRNRFHHFKNGSCSCNDYW 737 >ref|XP_006439922.1| hypothetical protein CICLE_v10024603mg [Citrus clementina] gi|557542184|gb|ESR53162.1| hypothetical protein CICLE_v10024603mg [Citrus clementina] Length = 695 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H+ATK IS V++REI+VRDR RFHHF+ GSCSCNDYW Sbjct: 659 HNATKIISKVFNREIVVRDRTRFHHFKEGSCSCNDYW 695 >gb|EMT15321.1| hypothetical protein F775_05476 [Aegilops tauschii] Length = 542 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H ATK IS V++REI+VRDR RFHHFR G+CSCNDYW Sbjct: 397 HEATKLISRVFEREIVVRDRNRFHHFRDGACSCNDYW 433 >ref|XP_003632122.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 577 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSA K IS + REI+VRDRKRFHHFR GSCSCNDYW Sbjct: 541 HSAMKLISNAFKREIIVRDRKRFHHFRNGSCSCNDYW 577 >emb|CBI15839.3| unnamed protein product [Vitis vinifera] Length = 505 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSA K IS + REI+VRDRKRFHHFR GSCSCNDYW Sbjct: 469 HSAMKLISNAFKREIIVRDRKRFHHFRNGSCSCNDYW 505 >gb|EXB60277.1| hypothetical protein L484_005875 [Morus notabilis] Length = 720 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H ATK IS + +REI+VRDR RFHHF+YG CSCNDYW Sbjct: 684 HDATKIISKIVNREIVVRDRSRFHHFKYGRCSCNDYW 720 >ref|XP_006410036.1| hypothetical protein EUTSA_v10016305mg [Eutrema salsugineum] gi|557111205|gb|ESQ51489.1| hypothetical protein EUTSA_v10016305mg [Eutrema salsugineum] Length = 739 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HS K IS VYDREI+VRDR RFHHFR G CSCND+W Sbjct: 703 HSVAKLISQVYDREIIVRDRYRFHHFRNGQCSCNDFW 739 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 HSATK IS +++REI+ RDR RFHHF+ GSCSCNDYW Sbjct: 698 HSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDYW 734 >emb|CBI24015.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H A+K IS VYDREI++RDR RFHHFR G CSC DYW Sbjct: 533 HQASKLISKVYDREIIIRDRNRFHHFRMGGCSCKDYW 569 >emb|CBI14948.3| unnamed protein product [Vitis vinifera] Length = 401 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +3 Query: 3 HSATKFISMVYDREILVRDRKRFHHFRYGSCSCNDYW 113 H+ATK +S V++REI+VRDR RFHHF+ GSCSCNDYW Sbjct: 365 HNATKLVSKVFNREIVVRDRTRFHHFKEGSCSCNDYW 401