BLASTX nr result
ID: Sinomenium22_contig00046715
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046715 (397 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74003.1| hypothetical protein VITISV_006234 [Vitis vinifera] 44 2e-07 emb|CAN72844.1| hypothetical protein VITISV_009107 [Vitis vinifera] 40 1e-06 emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] 42 2e-06 emb|CAN66542.1| hypothetical protein VITISV_035205 [Vitis vinifera] 42 2e-06 emb|CAN74944.1| hypothetical protein VITISV_000894 [Vitis vinifera] 42 2e-06 emb|CAN75156.1| hypothetical protein VITISV_042643 [Vitis vinifera] 42 2e-06 emb|CAN73503.1| hypothetical protein VITISV_008255 [Vitis vinifera] 42 2e-06 emb|CAN62833.1| hypothetical protein VITISV_012130 [Vitis vinifera] 41 2e-06 emb|CAN73539.1| hypothetical protein VITISV_037097 [Vitis vinifera] 40 2e-06 emb|CAN63022.1| hypothetical protein VITISV_042518 [Vitis vinifera] 40 2e-06 emb|CAN68820.1| hypothetical protein VITISV_009132 [Vitis vinifera] 40 4e-06 emb|CAN83725.1| hypothetical protein VITISV_037053 [Vitis vinifera] 42 4e-06 emb|CAN66330.1| hypothetical protein VITISV_000598 [Vitis vinifera] 40 5e-06 emb|CAN75609.1| hypothetical protein VITISV_002943 [Vitis vinifera] 42 5e-06 emb|CAN82685.1| hypothetical protein VITISV_000485 [Vitis vinifera] 40 5e-06 emb|CAN83063.1| hypothetical protein VITISV_010308 [Vitis vinifera] 40 5e-06 emb|CAN70431.1| hypothetical protein VITISV_030910 [Vitis vinifera] 39 6e-06 emb|CAN77207.1| hypothetical protein VITISV_014785 [Vitis vinifera] 42 6e-06 emb|CAN72548.1| hypothetical protein VITISV_035350 [Vitis vinifera] 39 6e-06 emb|CAN77570.1| hypothetical protein VITISV_008516 [Vitis vinifera] 41 8e-06 >emb|CAN74003.1| hypothetical protein VITISV_006234 [Vitis vinifera] Length = 558 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 30/61 (49%), Positives = 34/61 (55%), Gaps = 6/61 (9%) Frame = -3 Query: 167 SSLNSA----SIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLK 6 SSLNS S D R W L SGS S KSFFN+L V NP + F F+W SK+ K Sbjct: 313 SSLNSVLLSPSSSDSRAWSLSSSGSFSVKSFFNALSKVSNPLM--FLPTKFVWSSKVPSK 370 Query: 5 V 3 V Sbjct: 371 V 371 Score = 36.6 bits (83), Expect(2) = 2e-07 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L+ V Sbjct: 290 LSWNFNFRRNLTDSEIDLLQRLMSSLNSV 318 >emb|CAN72844.1| hypothetical protein VITISV_009107 [Vitis vinifera] Length = 506 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 21/51 (41%), Positives = 26/51 (50%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L SG + KSFF L P + F F+WKS++ KV Sbjct: 162 STSASDARSWSLCSSGLFTVKSFFAVLSQMPDSSPFFPTKFVWKSQVPFKV 212 Score = 38.1 bits (87), Expect(2) = 1e-06 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = -1 Query: 271 SDFSSYSCLSWNLKLRRNLRDSEIDILGSLIHVLD 167 S F S SWN RRNL DSEI+ L L+H LD Sbjct: 123 SIFGSSRPFSWNFNFRRNLTDSEIEXLERLMHSLD 157 >emb|CAN74312.1| hypothetical protein VITISV_037520 [Vitis vinifera] Length = 1915 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 167 SSLNSASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S L S S D R W L SGS S KSFF +L + F FLW SK+ KV Sbjct: 1706 SVLLSPSSXDSRAWSLSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKV 1760 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L V Sbjct: 1679 LSWNFNFRRNLTDSEIDLLQRLMSSLHSV 1707 >emb|CAN66542.1| hypothetical protein VITISV_035205 [Vitis vinifera] Length = 1848 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L SG + KSFF +L P + F F+WKS++ KV Sbjct: 1500 STSASDARSWSLCSSGLFTVKSFFTALSQMPDSSPFFPTKFVWKSQVPFKV 1550 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 244 SWNLKLRRNLRDSEIDILGSLIHVLD 167 SWN RRNL DSEI+ L L+H LD Sbjct: 1470 SWNFNFRRNLTDSEIEDLERLMHSLD 1495 >emb|CAN74944.1| hypothetical protein VITISV_000894 [Vitis vinifera] Length = 1675 Score = 42.0 bits (97), Expect(2) = 2e-06 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L SG + KSFF +L P + F F+WKS++ KV Sbjct: 1527 STSASDARSWSLCSSGLFTVKSFFTALSQMPDSSPFFPTKFVWKSQVPFKV 1577 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 244 SWNLKLRRNLRDSEIDILGSLIHVLD 167 SWN RRNL DSEI+ L L+H LD Sbjct: 1497 SWNFNFRRNLTDSEIEDLKRLMHSLD 1522 >emb|CAN75156.1| hypothetical protein VITISV_042643 [Vitis vinifera] Length = 721 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 167 SSLNSASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S L S S D R W L SGS S KSFF +L + F FLW SK+ KV Sbjct: 508 SVLLSPSSSDSRAWSLSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKV 562 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L V Sbjct: 481 LSWNFNFRRNLTDSEIDLLQRLMSSLHSV 509 >emb|CAN73503.1| hypothetical protein VITISV_008255 [Vitis vinifera] Length = 617 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 167 SSLNSASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S L S S D R W L SGS S KSFF +L + F FLW SK+ KV Sbjct: 490 SVLLSPSSSDSRAWSLSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKV 544 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L V Sbjct: 463 LSWNFNFRRNLTDSEIDLLQRLMSSLHSV 491 >emb|CAN62833.1| hypothetical protein VITISV_012130 [Vitis vinifera] Length = 1621 Score = 41.2 bits (95), Expect(2) = 2e-06 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 167 SSLNSASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S L S S D R W L SGS S KSFF +L + F FLW SK+ KV Sbjct: 538 SVLLSPSSSDSRAWSLSSSGSFSVKSFFYALSRDSNPLMFLPAKFLWSSKVPSKV 592 Score = 35.8 bits (81), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L V Sbjct: 511 LSWNFNFRRNLTDSEIDLLQRLMSSLHSV 539 >emb|CAN73539.1| hypothetical protein VITISV_037097 [Vitis vinifera] Length = 943 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG S KSFF +L V NP + F FLW SK+ KV Sbjct: 783 SPSLADSRVWSLSSSGLFSVKSFFLALSKVSNPIL--FLPAKFLWSSKVPSKV 833 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID+L L+ L V Sbjct: 752 LAWNLNFRRNLTDSEIDLLQRLMSSLSSV 780 >emb|CAN63022.1| hypothetical protein VITISV_042518 [Vitis vinifera] Length = 311 Score = 40.4 bits (93), Expect(2) = 2e-06 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG S KSFF +L V NP + F FLW SK+ KV Sbjct: 99 SPSLADSRVWSLSSSGLFSVKSFFLALSKVSNPIL--FLPAKFLWSSKVPSKV 149 Score = 36.6 bits (83), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID+L L+ L V Sbjct: 68 LAWNLNFRRNLTDSEIDLLQRLMSSLSSV 96 >emb|CAN68820.1| hypothetical protein VITISV_009132 [Vitis vinifera] Length = 1910 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG +S KSFF +L V NP + F FLW SK KV Sbjct: 1726 SPSLADSRVWSLSSSGLLSVKSFFLALSKVSNPIL--FLPAKFLWSSKAPSKV 1776 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID+L L+ L V Sbjct: 1695 LAWNLNFRRNLTDSEIDLLQRLMSSLSSV 1723 >emb|CAN83725.1| hypothetical protein VITISV_037053 [Vitis vinifera] Length = 1726 Score = 42.4 bits (98), Expect(2) = 4e-06 Identities = 30/61 (49%), Positives = 33/61 (54%), Gaps = 6/61 (9%) Frame = -3 Query: 167 SSLN----SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLK 6 SSLN S S D R W L SGS S KSFF +L V NP + F FLW SK+ K Sbjct: 1455 SSLNFVLLSPSSSDSRVWSLSSSGSFSVKSFFYALSKVSNPLM--FLPAKFLWSSKVPSK 1512 Query: 5 V 3 V Sbjct: 1513 V 1513 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DS+ID+L L+ L+ V Sbjct: 1432 LSWNFNFRRNLTDSKIDLLQRLMSSLNFV 1460 >emb|CAN66330.1| hypothetical protein VITISV_000598 [Vitis vinifera] Length = 2691 Score = 40.4 bits (93), Expect(2) = 5e-06 Identities = 20/51 (39%), Positives = 27/51 (52%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L +G + KSFF +L P + F F+WKS++ KV Sbjct: 2435 STSASDARSWSLCSTGLFTVKSFFTALSQMPDSSPFFPTKFVWKSQVLFKV 2485 Score = 35.4 bits (80), Expect(2) = 5e-06 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -1 Query: 244 SWNLKLRRNLRDSEIDILGSLIHVLD 167 SWN RRNL DSEI+ L L+H LD Sbjct: 2405 SWNFNFRRNLTDSEIEDLERLMHSLD 2430 >emb|CAN75609.1| hypothetical protein VITISV_002943 [Vitis vinifera] Length = 1599 Score = 41.6 bits (96), Expect(2) = 5e-06 Identities = 25/55 (45%), Positives = 28/55 (50%) Frame = -3 Query: 167 SSLNSASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S L S S D R W L SGS S KSFF +L + F FLW SK+ KV Sbjct: 857 SVLLSPSSSDSRAWSLSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKV 911 Score = 34.3 bits (77), Expect(2) = 5e-06 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+ L+ L V Sbjct: 830 LSWNFNFRRNLTDSEIDLFQRLMSSLHSV 858 >emb|CAN82685.1| hypothetical protein VITISV_000485 [Vitis vinifera] Length = 1563 Score = 40.0 bits (92), Expect(2) = 5e-06 Identities = 25/53 (47%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG S KSFF +L V NP + F FLW SK+ KV Sbjct: 953 SPSLADSRAWSLSSSGLFSVKSFFLALSKVSNPIL--FLPAKFLWSSKVPSKV 1003 Score = 35.8 bits (81), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID L L+ L V Sbjct: 922 LAWNLNFRRNLTDSEIDFLQRLMSSLSSV 950 >emb|CAN83063.1| hypothetical protein VITISV_010308 [Vitis vinifera] Length = 988 Score = 39.7 bits (91), Expect(2) = 5e-06 Identities = 28/61 (45%), Positives = 32/61 (52%), Gaps = 6/61 (9%) Frame = -3 Query: 167 SSLNSASIP----DKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLK 6 SSLNS + D R W L SGS S K FF +L V NP + F FLW SK+ K Sbjct: 768 SSLNSVLLSPXXSDSRAWSLSSSGSFSVKXFFYALSKVSNPLM--FLPAKFLWSSKVPSK 825 Query: 5 V 3 V Sbjct: 826 V 826 Score = 36.2 bits (82), Expect(2) = 5e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 LSWN RRNL DSEID+L L+ L+ V Sbjct: 745 LSWNFXFRRNLTDSEIDLLQRLMSSLNSV 773 >emb|CAN70431.1| hypothetical protein VITISV_030910 [Vitis vinifera] Length = 971 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG + KSFF +L V NP + F FLW SK+ KV Sbjct: 667 SPSLADSRAWSLSSSGLFTVKSFFLALSKVSNPIL--FLPAKFLWSSKVPSKV 717 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID+L L+ L V Sbjct: 636 LAWNLNFRRNLTDSEIDLLQRLMSSLSSV 664 >emb|CAN77207.1| hypothetical protein VITISV_014785 [Vitis vinifera] Length = 943 Score = 42.0 bits (97), Expect(2) = 6e-06 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L SG + KSFF +L P + F F+WKS++ KV Sbjct: 726 STSASDARSWSLCSSGLFTVKSFFTALSQMPDSSPFFPTKFVWKSQVPFKV 776 Score = 33.5 bits (75), Expect(2) = 6e-06 Identities = 15/26 (57%), Positives = 17/26 (65%) Frame = -1 Query: 244 SWNLKLRRNLRDSEIDILGSLIHVLD 167 SWN RRNL D EI+ L L+H LD Sbjct: 696 SWNFNFRRNLTDPEIEDLERLMHSLD 721 >emb|CAN72548.1| hypothetical protein VITISV_035350 [Vitis vinifera] Length = 306 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSL--VDNPPINCFHYKSFLWKSKISLKV 3 S S+ D R W L SG + KSFF +L V NP + F FLW SK+ KV Sbjct: 107 SPSLADSRAWSLSSSGLFTVKSFFLALSKVSNPIL--FLPAKFLWSSKVPSKV 157 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -1 Query: 247 LSWNLKLRRNLRDSEIDILGSLIHVLDQV 161 L+WNL RRNL DSEID+L L+ L V Sbjct: 76 LAWNLNFRRNLTDSEIDLLQRLMSSLSSV 104 >emb|CAN77570.1| hypothetical protein VITISV_008516 [Vitis vinifera] Length = 1946 Score = 40.8 bits (94), Expect(2) = 8e-06 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = -3 Query: 155 SASIPDKRFWKLHKSGSVSCKSFFNSLVDNPPINCFHYKSFLWKSKISLKV 3 S S D R W L SG + KSFF +L P + F F+WKS++ KV Sbjct: 1511 STSASDARSWSLLSSGLFTVKSFFIALSQMPDSSPFFPTKFVWKSQVPFKV 1561 Score = 34.3 bits (77), Expect(2) = 8e-06 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -1 Query: 295 ISKLKRCQSDFSSYSCLSWNLKLRRNLRDSEIDILGSLIHVLD 167 + K S S SWN RRNL DS+I+ L L+H LD Sbjct: 1464 MDKNSHISSILGSSRPFSWNFNFRRNLTDSKIEDLECLMHSLD 1506