BLASTX nr result
ID: Sinomenium22_contig00046695
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046695 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214504.1| hypothetical protein PRUPE_ppa016706mg, part... 57 3e-06 ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, part... 56 4e-06 >ref|XP_007214504.1| hypothetical protein PRUPE_ppa016706mg, partial [Prunus persica] gi|462410369|gb|EMJ15703.1| hypothetical protein PRUPE_ppa016706mg, partial [Prunus persica] Length = 992 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/70 (38%), Positives = 46/70 (65%) Frame = -3 Query: 238 MFFMEGREECFHTITRILKAFSWVSELKVNMTKSHLLGINMEIGVVEGLASSVGWSTGV* 59 +FF+E +EE ++ + +IL+ F +VS +K+N +K L+GIN++ G++ LA + G G Sbjct: 545 IFFIEDKEEYWNNLLQILELFCFVSVMKINKSKCSLVGINLDDGLLNELAGAWGCEVGAW 604 Query: 58 PMDYLEVGGG 29 PM YL + G Sbjct: 605 PMSYLGLPQG 614 >ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] gi|462421015|gb|EMJ25278.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] Length = 1419 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/65 (40%), Positives = 44/65 (67%) Frame = -3 Query: 238 MFFMEGREECFHTITRILKAFSWVSELKVNMTKSHLLGINMEIGVVEGLASSVGWSTGV* 59 +FF+E +EE ++ + +IL+ F +VS +K+N +K L+GIN++ G++ LA + G G Sbjct: 944 IFFIEDKEEYWNNLLQILELFCFVSGMKINKSKCSLVGINLDDGLLNELAGAWGCEVGAW 1003 Query: 58 PMDYL 44 PM YL Sbjct: 1004 PMSYL 1008