BLASTX nr result
ID: Sinomenium22_contig00046454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046454 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vi... 70 8e-10 >ref|XP_002269977.2| PREDICTED: histidine kinase 2-like [Vitis vinifera] Length = 1272 Score = 69.7 bits (169), Expect = 8e-10 Identities = 37/60 (61%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = +3 Query: 450 MSFSAVAGVFLKLPRLFLKICRWVLVRMAVNCKISGFQSILSVN-NTKQRKAHLQESRGV 626 MSFSAVAGVFLKL RL LKICRWVL++M++NCK+SGF L N K+ K L S V Sbjct: 1 MSFSAVAGVFLKLSRLILKICRWVLLKMSLNCKLSGFSGRLPANLKLKKSKEPLHGSNCV 60