BLASTX nr result
ID: Sinomenium22_contig00046196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00046196 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007211943.1| hypothetical protein PRUPE_ppa010783mg [Prun... 50 2e-07 ref|XP_007048412.1| Uncharacterized protein TCM_001506 [Theobrom... 49 2e-07 ref|XP_002526641.1| conserved hypothetical protein [Ricinus comm... 45 6e-07 >ref|XP_007211943.1| hypothetical protein PRUPE_ppa010783mg [Prunus persica] gi|462407808|gb|EMJ13142.1| hypothetical protein PRUPE_ppa010783mg [Prunus persica] Length = 236 Score = 50.4 bits (119), Expect(2) = 2e-07 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -1 Query: 119 ERDASESLNRRVSEAIELLERGRELQVQRNFVGALECFS 3 ERDAS++++RR+S+A+ELLE+GRELQ +F AL CF+ Sbjct: 90 ERDASDAISRRISDALELLEKGRELQALGDFNQALLCFT 128 Score = 30.4 bits (67), Expect(2) = 2e-07 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Frame = -3 Query: 345 GVCKEPIFHLLL---HSAPKSVNPKTPESFSTTPSHTTTGRLFLFSLSIPPALL 193 G CK PI HLL+ S + N K+ FS TP + RL LF+L + LL Sbjct: 2 GACKAPIPHLLMTCSSSLAQPPNLKSLNPFSKTP--LLSRRLVLFTLPLATFLL 53 >ref|XP_007048412.1| Uncharacterized protein TCM_001506 [Theobroma cacao] gi|508700673|gb|EOX92569.1| Uncharacterized protein TCM_001506 [Theobroma cacao] Length = 231 Score = 49.3 bits (116), Expect(2) = 2e-07 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = -1 Query: 119 ERDASESLNRRVSEAIELLERGRELQVQRNFVGALECFS 3 ERDAS + RRVSE +ELLERG+ELQ Q +F AL+ F+ Sbjct: 85 ERDASAVITRRVSEGVELLERGKELQAQGDFPKALQIFT 123 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 20/53 (37%), Positives = 23/53 (43%) Frame = -3 Query: 345 GVCKEPIFHLLLHSAPKSVNPKTPESFSTTPSHTTTGRLFLFSLSIPPALLFF 187 G K PIFHLL + P + K P TTT R LFSL + F Sbjct: 2 GAFKAPIFHLLSSANPNTETLKNP----LLNPETTTRRFLLFSLPLSTVSTLF 50 >ref|XP_002526641.1| conserved hypothetical protein [Ricinus communis] gi|223534033|gb|EEF35753.1| conserved hypothetical protein [Ricinus communis] Length = 227 Score = 45.1 bits (105), Expect(2) = 6e-07 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -1 Query: 119 ERDASESLNRRVSEAIELLERGRELQVQRNFVGALECFS 3 E+DAS + ++RVSEAI LLE+GRELQ Q +F AL F+ Sbjct: 81 EKDASANKSQRVSEAIGLLEKGRELQAQGDFSAALPYFT 119 Score = 33.9 bits (76), Expect(2) = 6e-07 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = -3 Query: 345 GVCKEPIFHLLLHSAPKSVNPKTPESFSTTPSHTTTGRLFLFSLSI 208 G CK PI HL S+P + NP+ S T R FLFSL + Sbjct: 6 GACKAPICHLQRPSSPSTPNPRNSNS---------TRRFFLFSLPL 42