BLASTX nr result
ID: Sinomenium22_contig00045871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045871 (566 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19678.3| unnamed protein product [Vitis vinifera] 58 2e-06 >emb|CBI19678.3| unnamed protein product [Vitis vinifera] Length = 278 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = -2 Query: 565 RSNEKTAATSVYDVHKGRKKITFADEAGGMLCHVKIFEDHPAPPLTLESEMADL 404 R E + S +HK RKKITFADEAGG+LCHVK+F D A PL E +L Sbjct: 222 RLTENESVASGNTIHKERKKITFADEAGGVLCHVKLFYDGMASPLEPNGEKQEL 275