BLASTX nr result
ID: Sinomenium22_contig00045791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045791 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007278360.1| cerato-ulmin [Colletotrichum gloeosporioides... 70 3e-10 gb|EQB58805.1| fungal hydrophobin [Colletotrichum gloeosporioide... 68 1e-09 sp|P52753.1|CRYP_CRYPA RecName: Full=Cryparin; Flags: Precursor ... 64 2e-08 gb|EXL67895.1| hypothetical protein FOPG_16016 [Fusarium oxyspor... 64 2e-08 gb|EXK86089.1| hypothetical protein FOQG_10136 [Fusarium oxyspor... 64 2e-08 gb|EXK86088.1| hypothetical protein FOQG_10136 [Fusarium oxyspor... 64 2e-08 ref|XP_007593862.1| hypothetical protein CFIO01_05189 [Colletotr... 64 2e-08 gb|EXA41542.1| hypothetical protein FOVG_10015 [Fusarium oxyspor... 64 2e-08 gb|EXA41541.1| hypothetical protein FOVG_10015 [Fusarium oxyspor... 64 2e-08 gb|EGU80400.1| hypothetical protein FOXB_09102 [Fusarium oxyspor... 64 2e-08 gb|ENH62319.1| Trihydrophobin [Fusarium oxysporum f. sp. cubense... 63 4e-08 gb|EXM14686.1| hypothetical protein FOTG_16939 [Fusarium oxyspor... 63 5e-08 gb|EXM14685.1| hypothetical protein FOTG_16939 [Fusarium oxyspor... 63 5e-08 gb|EXM08612.1| hypothetical protein FOIG_01689 [Fusarium oxyspor... 63 5e-08 gb|EXM08611.1| hypothetical protein FOIG_01689 [Fusarium oxyspor... 63 5e-08 gb|EXL44317.1| hypothetical protein FOCG_13311 [Fusarium oxyspor... 63 5e-08 gb|EXL44316.1| hypothetical protein FOCG_13311 [Fusarium oxyspor... 63 5e-08 gb|EXK33538.1| hypothetical protein FOMG_10808 [Fusarium oxyspor... 63 5e-08 gb|EXK33537.1| hypothetical protein FOMG_10808 [Fusarium oxyspor... 63 5e-08 gb|EWZ81862.1| hypothetical protein FOWG_14288 [Fusarium oxyspor... 63 5e-08 >ref|XP_007278360.1| cerato-ulmin [Colletotrichum gloeosporioides Nara gc5] gi|429857720|gb|ELA32569.1| cerato-ulmin [Colletotrichum gloeosporioides Nara gc5] Length = 103 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/56 (58%), Positives = 40/56 (71%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 + DV GVADL CAS TSVPSS F+ CA GQ A CC L V+G +++CQTPVG+ Sbjct: 48 ATDVLGVADLDCASPTSVPSSANDFRKICAVGGQRARCCVLPVLGQAVLCQTPVGV 103 >gb|EQB58805.1| fungal hydrophobin [Colletotrichum gloeosporioides Cg-14] Length = 103 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/56 (57%), Positives = 40/56 (71%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 + DV GVA+L CAS TSVPSS F+ CA GQ A CC L V+G +++CQTPVG+ Sbjct: 48 ATDVLGVANLDCASPTSVPSSANDFRKICAVGGQRARCCVLPVLGQAVLCQTPVGV 103 >sp|P52753.1|CRYP_CRYPA RecName: Full=Cryparin; Flags: Precursor gi|305085|gb|AAA19638.1| cryparin [Cryphonectria parasitica] Length = 118 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 + DV GVADL C +V P+S +F+ CA SG+ A CCT+ ++G +L+CQ PVGL Sbjct: 63 ATDVLGVADLDCETVPETPTSASSFESICATSGRDAKCCTIPLLGQALLCQDPVGL 118 >gb|EXL67895.1| hypothetical protein FOPG_16016 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 564 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 507 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 562 >gb|EXK86089.1| hypothetical protein FOQG_10136 [Fusarium oxysporum f. sp. raphani 54005] Length = 565 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXK86088.1| hypothetical protein FOQG_10136 [Fusarium oxysporum f. sp. raphani 54005] Length = 566 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >ref|XP_007593862.1| hypothetical protein CFIO01_05189 [Colletotrichum fioriniae PJ7] gi|588902088|gb|EXF82466.1| hypothetical protein CFIO01_05189 [Colletotrichum fioriniae PJ7] Length = 98 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 + DV GVADL CAS +VP++ + CA++GQ A CC L V+G +++CQTPVG+ Sbjct: 43 ATDVLGVADLDCASSPTVPTTASDLRSICAKAGQRARCCVLPVLGQAVLCQTPVGV 98 >gb|EXA41542.1| hypothetical protein FOVG_10015 [Fusarium oxysporum f. sp. pisi HDV247] Length = 565 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXA41541.1| hypothetical protein FOVG_10015 [Fusarium oxysporum f. sp. pisi HDV247] Length = 566 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >gb|EGU80400.1| hypothetical protein FOXB_09102 [Fusarium oxysporum Fo5176] gi|591434883|gb|EXL67894.1| hypothetical protein FOPG_16016 [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 565 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/56 (55%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ E F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDAENFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|ENH62319.1| Trihydrophobin [Fusarium oxysporum f. sp. cubense race 1] Length = 565 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTEFPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXM14686.1| hypothetical protein FOTG_16939 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 565 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXM14685.1| hypothetical protein FOTG_16939 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 566 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >gb|EXM08612.1| hypothetical protein FOIG_01689 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 565 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXM08611.1| hypothetical protein FOIG_01689 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 566 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >gb|EXL44317.1| hypothetical protein FOCG_13311 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 565 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXL44316.1| hypothetical protein FOCG_13311 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] Length = 566 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >gb|EXK33538.1| hypothetical protein FOMG_10808 [Fusarium oxysporum f. sp. melonis 26406] Length = 565 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563 >gb|EXK33537.1| hypothetical protein FOMG_10808 [Fusarium oxysporum f. sp. melonis 26406] Length = 566 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 509 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 564 >gb|EWZ81862.1| hypothetical protein FOWG_14288 [Fusarium oxysporum f. sp. lycopersici MN25] Length = 565 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = +2 Query: 2 SADVGGVADLTCASVTSVPSSPEAFKDTCAESGQTAMCCTLTVVGVSLVCQTPVGL 169 S DV GVAD+ C S T P+ + F+ CA SGQ A CC L V+G +LVC TPVG+ Sbjct: 508 SVDVLGVADVECDSPTESPTDADNFQAICAASGQRARCCVLPVLGQALVCLTPVGV 563