BLASTX nr result
ID: Sinomenium22_contig00045659
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045659 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279218.2| PREDICTED: receptor-like protein kinase FERO... 88 1e-15 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notab... 86 4e-15 ref|NP_001238686.1| receptor-like kinase [Glycine max] gi|223452... 86 4e-15 ref|XP_002528705.1| kinase, putative [Ricinus communis] gi|22353... 86 5e-15 ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prun... 85 9e-15 ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago trunc... 85 9e-15 gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Mimulus... 85 1e-14 ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phas... 85 1e-14 ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phas... 85 1e-14 ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glyc... 85 1e-14 ref|XP_002308259.1| kinase family protein [Populus trichocarpa] ... 85 1e-14 ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERO... 84 2e-14 ref|XP_007033491.1| Malectin/receptor-like protein kinase family... 83 3e-14 ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citr... 83 4e-14 gb|ABY40731.1| FERONIA receptor-like kinase [Citrus trifoliata] 83 4e-14 ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidops... 82 6e-14 ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Caps... 82 6e-14 ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERO... 82 6e-14 gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana] 82 6e-14 ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arab... 82 6e-14 >ref|XP_002279218.2| PREDICTED: receptor-like protein kinase FERONIA-like, partial [Vitis vinifera] Length = 481 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/44 (97%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 438 DGNVTDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 481 >gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis] Length = 888 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSGM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 845 DGNVTDSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 888 >ref|NP_001238686.1| receptor-like kinase [Glycine max] gi|223452309|gb|ACM89482.1| receptor-like kinase [Glycine max] Length = 883 Score = 86.3 bits (212), Expect = 4e-15 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGNATDSRSSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 840 DGNATDSRSSGISMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 883 >ref|XP_002528705.1| kinase, putative [Ricinus communis] gi|223531877|gb|EEF33694.1| kinase, putative [Ricinus communis] Length = 891 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSGM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 848 DGNITDSRSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891 >ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica] gi|462404044|gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica] Length = 891 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSGM+MSIGGRSLAS+DSDGLTPSAVFSQIMNPKGR Sbjct: 848 DGNVTDSRSSGMSMSIGGRSLASDDSDGLTPSAVFSQIMNPKGR 891 >ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula] gi|355510153|gb|AES91295.1| FERONIA receptor-like kinase [Medicago truncatula] Length = 893 Score = 85.1 bits (209), Expect = 9e-15 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDS+SSGM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 DGNVTDSKSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Mimulus guttatus] Length = 837 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDS+SSGM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 794 DGNITDSKSSGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 837 >ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris] gi|561013212|gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris] Length = 898 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 855 DGNVTDSRSSGISMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 898 >ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris] gi|561013195|gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris] Length = 899 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 856 DGNVTDSRSSGISMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 899 >ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max] gi|223452393|gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max] Length = 892 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 849 DGNVTDSRSSGISMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 892 >ref|XP_002308259.1| kinase family protein [Populus trichocarpa] gi|222854235|gb|EEE91782.1| kinase family protein [Populus trichocarpa] Length = 893 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/44 (93%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 DGNVTDSRSSGISMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum] Length = 896 Score = 84.0 bits (206), Expect = 2e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDS+SSG++MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 853 DGNVTDSKSSGLSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 896 >ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma cacao] gi|508712520|gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma cacao] Length = 892 Score = 83.2 bits (204), Expect = 3e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 D N TDSRSSGM+MS+GGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 849 DANVTDSRSSGMSMSLGGRSLASEDSDGLTPSAVFSQIMNPKGR 892 >ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina] gi|568855252|ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus sinensis] gi|557531674|gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina] Length = 895 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRS+GM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 852 NGNITDSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 895 >gb|ABY40731.1| FERONIA receptor-like kinase [Citrus trifoliata] Length = 447 Score = 82.8 bits (203), Expect = 4e-14 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRS+GM+MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 404 NGNITDSRSTGMSMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 447 >ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana] gi|75337066|sp|Q9SCZ4.1|FER_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: Full=Protein SIRENE; Flags: Precursor gi|6572076|emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana] gi|332645284|gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana] Length = 895 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRSSG+ MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 852 EGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 895 >ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella] gi|482559291|gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella] Length = 892 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRSSG+ MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 849 EGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 892 >ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA-like [Fragaria vesca subsp. vesca] Length = 883 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 DGN TDSRSSG++MS+GGRSLAS+DSDGLTPSAVFSQIMNPKGR Sbjct: 840 DGNGTDSRSSGISMSMGGRSLASDDSDGLTPSAVFSQIMNPKGR 883 >gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana] Length = 893 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRSSG+ MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 850 EGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 893 >ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. lyrata] gi|155242124|gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata] gi|297323647|gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. lyrata] Length = 891 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = -3 Query: 374 DGNATDSRSSGMTMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 243 +GN TDSRSSG+ MSIGGRSLASEDSDGLTPSAVFSQIMNPKGR Sbjct: 848 EGNVTDSRSSGIDMSIGGRSLASEDSDGLTPSAVFSQIMNPKGR 891