BLASTX nr result
ID: Sinomenium22_contig00045422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045422 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyen... 64 2e-08 >gb|EPE32683.1| hypothetical protein GLAREA_07817 [Glarea lozoyensis ATCC 20868] Length = 306 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 34/53 (64%) Frame = +2 Query: 116 KTSSGYGXXXXXXXXXXXTAGKLMEKAGGMFKNEGLAEKGREKREAAGADTYG 274 +TS GYG T GKLMEKAGGM KNEGL EKG++KR AG D YG Sbjct: 243 RTSDGYGDNEGSGGKKDSTMGKLMEKAGGMLKNEGLVEKGQQKRAGAGNDEYG 295