BLASTX nr result
ID: Sinomenium22_contig00045396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045396 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857086.1| hypothetical protein AMTR_s00065p00103530 [A... 40 4e-07 >ref|XP_006857086.1| hypothetical protein AMTR_s00065p00103530 [Amborella trichopoda] gi|548861169|gb|ERN18553.1| hypothetical protein AMTR_s00065p00103530 [Amborella trichopoda] Length = 424 Score = 40.4 bits (93), Expect(2) = 4e-07 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +1 Query: 190 QTITDGEHQCRYMEDSKN-SPVSVLELPLEEGS 285 + + D H+C + EDSK SPVSVL+LP +EGS Sbjct: 176 EAVADRNHECGFFEDSKQLSPVSVLDLPCDEGS 208 Score = 39.3 bits (90), Expect(2) = 4e-07 Identities = 16/32 (50%), Positives = 24/32 (75%) Frame = +2 Query: 389 TAVFCTRANKKEIPSTSNFKLPKKVTQDSIFS 484 T FC R +E PS+++FKL +K+T++SIFS Sbjct: 216 TDQFCNRTTNEEYPSSTSFKLTQKITEESIFS 247