BLASTX nr result
ID: Sinomenium22_contig00045068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045068 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT40504.2| Polyprotein, putative [Solanum demissum] 54 3e-06 >gb|AAT40504.2| Polyprotein, putative [Solanum demissum] Length = 868 Score = 53.5 bits (127), Expect(2) = 3e-06 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 1/78 (1%) Frame = +3 Query: 48 MSVM*M*MFRYIYGLTLKDKVKNEHIRKMV-VPLIGDEMRKHLLM*FGHI**RPLNEPVM 224 M V M M R++ G T DK++NE IR+ V V + D++R+ L FGH+ R + PV Sbjct: 579 MHVAEMRMLRWMCGHTRSDKIRNEVIREKVGVASVVDKLREARLRWFGHVKRRSADAPVR 638 Query: 225 KNDLLSINGSTRERGRPK 278 + +++ + G+ R RGRPK Sbjct: 639 RCEVMVVEGTRRGRGRPK 656 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = +2 Query: 8 AMLYGVECW 34 A+LYG ECW Sbjct: 561 ALLYGAECW 569