BLASTX nr result
ID: Sinomenium22_contig00045064
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00045064 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63091.1| hypothetical protein VITISV_032018 [Vitis vinifera] 56 5e-06 >emb|CAN63091.1| hypothetical protein VITISV_032018 [Vitis vinifera] Length = 580 Score = 56.2 bits (134), Expect = 5e-06 Identities = 38/106 (35%), Positives = 51/106 (48%), Gaps = 6/106 (5%) Frame = -3 Query: 300 INGNEESCGPSFSDSASTVMASVDV------SGISISCLMERTDELVCGSTSFKGXXXXX 139 + + ESCG SFSDSASTVMA V++ SG+ + L+ + + KG Sbjct: 475 VGTSRESCGASFSDSASTVMAGVEMAGGGGGSGVVGTSLVGLAGRRAGRAAAGKGSAMEV 534 Query: 138 XXXXXECCSWPEVDLDYVSEIKGCDGGESGDEWMERVLSVGPFEFE 1 C PE + GCDG E DEW+ RVLS GP + + Sbjct: 535 AKEE---CYVPEFVAVGGERMDGCDGLEFDDEWLSRVLSWGPLDLD 577