BLASTX nr result
ID: Sinomenium22_contig00044485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00044485 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 92 6e-21 gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] 62 6e-08 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 61 2e-07 ref|XP_004987296.1| PREDICTED: uncharacterized protein LOC101768... 58 1e-06 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 91.7 bits (226), Expect(2) = 6e-21 Identities = 42/46 (91%), Positives = 42/46 (91%) Frame = -1 Query: 140 HRGVVARVSRPGILHLAFMISTFNCAPETWSKHARPVCFFHDMPWS 3 H GVVARVSRPGILHLAFMISTF CAPET SKHARPVCFFHDM WS Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 Score = 34.7 bits (78), Expect(2) = 6e-21 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 175 GRRGPGCASDRHIG 134 GRRGPGCASDRH+G Sbjct: 742 GRRGPGCASDRHMG 755 >gb|EXB63584.1| hypothetical protein L484_026923 [Morus notabilis] Length = 64 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +2 Query: 101 GYQAEKPGQPLPYVPIASASRAPAPGSDGEA 193 GYQAEKPGQPLPYVPIASASRAPAP S GEA Sbjct: 34 GYQAEKPGQPLPYVPIASASRAPAPSSAGEA 64 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = -1 Query: 86 MISTFNCAPETWSKHARPVCFFHDMPWS 3 MISTFNCAPET SKHARPVCFFHDM WS Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWS 28 >ref|XP_004987296.1| PREDICTED: uncharacterized protein LOC101768809 [Setaria italica] Length = 71 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 86 MISTFNCAPETWSKHARPVCFFHDMPWS 3 MISTFNCAPET SKHARPVC FHDM WS Sbjct: 1 MISTFNCAPETRSKHARPVCVFHDMLWS 28