BLASTX nr result
ID: Sinomenium22_contig00044420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00044420 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC16973.1| hypothetical protein L484_021630 [Morus notabilis] 59 5e-07 >gb|EXC16973.1| hypothetical protein L484_021630 [Morus notabilis] Length = 533 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/47 (53%), Positives = 37/47 (78%) Frame = +1 Query: 1 FCQIPAKSTADQCPPENVVEVLNSRLQNEDIDDMEALNSSNRTASID 141 FCQ+ K+ AD+CPP+NV+E+LNS+L +E D ++LNSSN T S++ Sbjct: 485 FCQMSPKNPADKCPPDNVLEILNSQLGSEATSDPDSLNSSNSTRSVE 531