BLASTX nr result
ID: Sinomenium22_contig00044031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00044031 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77126.1| hypothetical protein VITISV_013628 [Vitis vinifera] 67 2e-09 emb|CAN79393.1| hypothetical protein VITISV_010428 [Vitis vinifera] 58 1e-06 >emb|CAN77126.1| hypothetical protein VITISV_013628 [Vitis vinifera] Length = 678 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = -3 Query: 179 SCKWRPRGSHFQASRKPQCQICGKFGHIAFNCYHRTNLSYHPRAPMVQASPSVTAPQAA 3 S KW + +PQCQICGKFGH+A NCYHR NL+Y P+ P Q P P AA Sbjct: 225 SSKWFQKQGTGNFGPRPQCQICGKFGHMALNCYHRANLNYQPQFPNSQPKPQPPNPIAA 283 >emb|CAN79393.1| hypothetical protein VITISV_010428 [Vitis vinifera] Length = 864 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/42 (59%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 173 KWRPRGSHFQA-SRKPQCQICGKFGHIAFNCYHRTNLSYHPR 51 +W+P HF ++KPQCQICGKFGHIA C+H TNL+Y P+ Sbjct: 184 QWKP---HFSIQNQKPQCQICGKFGHIALICFHXTNLNYSPQ 222