BLASTX nr result
ID: Sinomenium22_contig00043392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00043392 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006440915.1| hypothetical protein CICLE_v10019681mg [Citr... 60 2e-07 ref|XP_007036430.1| Transmembrane Fragile-X-F-associated protein... 57 3e-06 >ref|XP_006440915.1| hypothetical protein CICLE_v10019681mg [Citrus clementina] gi|557543177|gb|ESR54155.1| hypothetical protein CICLE_v10019681mg [Citrus clementina] Length = 447 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 1 EKILCRICFLSEISIVLLPCRHRVLCRYKHLLI 99 EK+LCR+CF +IS+VLLPCRHR+LCRY HL + Sbjct: 415 EKVLCRVCFEGDISVVLLPCRHRILCRYDHLTL 447 >ref|XP_007036430.1| Transmembrane Fragile-X-F-associated protein isoform 2 [Theobroma cacao] gi|508773675|gb|EOY20931.1| Transmembrane Fragile-X-F-associated protein isoform 2 [Theobroma cacao] Length = 421 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = +1 Query: 1 EKILCRICFLSEISIVLLPCRHRVLCRYKHLLI 99 EK+LCR+CF EIS+VLLPCRHR+LCRY ++ Sbjct: 370 EKVLCRVCFEREISVVLLPCRHRILCRYNMAIL 402