BLASTX nr result
ID: Sinomenium22_contig00042753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042753 (550 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20922.3| unnamed protein product [Vitis vinifera] 59 1e-06 gb|EYU20463.1| hypothetical protein MIMGU_mgv1a021894mg, partial... 57 3e-06 ref|XP_007224059.1| hypothetical protein PRUPE_ppa015277mg [Prun... 55 9e-06 >emb|CBI20922.3| unnamed protein product [Vitis vinifera] Length = 628 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 550 AMDWCLLQARSDSWWKDLYKQHGNEIRKLKANLKFK 443 AMDWCL Q RSDS WK LYK+ G+E+RKLKA+LK K Sbjct: 593 AMDWCLQQERSDSCWKKLYKRQGDELRKLKASLKSK 628 >gb|EYU20463.1| hypothetical protein MIMGU_mgv1a021894mg, partial [Mimulus guttatus] Length = 179 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/36 (61%), Positives = 28/36 (77%) Frame = -1 Query: 550 AMDWCLLQARSDSWWKDLYKQHGNEIRKLKANLKFK 443 AMDWCLLQ++SD WW LY+Q G E+++LKA K K Sbjct: 144 AMDWCLLQSKSDKWWAKLYEQQGKELKRLKAGFKSK 179 >ref|XP_007224059.1| hypothetical protein PRUPE_ppa015277mg [Prunus persica] gi|462420995|gb|EMJ25258.1| hypothetical protein PRUPE_ppa015277mg [Prunus persica] Length = 675 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -1 Query: 550 AMDWCLLQARSDSWWKDLYKQHGNEIRKLKANLKFK 443 AM+WCLLQ RSD W +LYKQ G E+RKLKA LK K Sbjct: 640 AMEWCLLQERSDLVWGNLYKQQGKELRKLKAELKAK 675