BLASTX nr result
ID: Sinomenium22_contig00042625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042625 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Popu... 51 6e-06 >ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] gi|222867445|gb|EEF04576.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 50.8 bits (120), Expect(2) = 6e-06 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 11/43 (25%) Frame = -1 Query: 275 VMISLKACFS-----------ENIRSGRLRAFAFAGVESLCCY 180 +MI+ KACFS +NIRSGRLRAFAFAG+ESLCC+ Sbjct: 1 MMINPKACFSKHSQWPSKLVSQNIRSGRLRAFAFAGLESLCCF 43 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 202 GLRACAATILPWMSET 155 GL + ILPWMSET Sbjct: 36 GLESLCCFILPWMSET 51