BLASTX nr result
ID: Sinomenium22_contig00042550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042550 (697 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA58483.1| TPA: putative cytochrome P450 superfamily protei... 57 6e-06 >tpg|DAA58483.1| TPA: putative cytochrome P450 superfamily protein [Zea mays] Length = 539 Score = 57.0 bits (136), Expect = 6e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 FGLGPKICISQNFALIEAKMCLSMILQRFSFR 96 FG GP+ICI QNFAL+EAKM LSMILQRF FR Sbjct: 480 FGWGPRICIGQNFALLEAKMALSMILQRFQFR 511