BLASTX nr result
ID: Sinomenium22_contig00042370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042370 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282803.1| PREDICTED: pentatricopeptide repeat-containi... 56 5e-06 emb|CAN74403.1| hypothetical protein VITISV_043633 [Vitis vinifera] 56 5e-06 >ref|XP_002282803.1| PREDICTED: pentatricopeptide repeat-containing protein At2g40720-like [Vitis vinifera] Length = 854 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 482 FTAGDRSYPQSNRIYTKLSSLTTFIKENGYVPDLRWVLQD 363 F+AGDRS+PQS++IY KLS L + ++E GY PDLRWV + Sbjct: 812 FSAGDRSHPQSDKIYAKLSILLSSMRETGYDPDLRWVFHE 851 >emb|CAN74403.1| hypothetical protein VITISV_043633 [Vitis vinifera] Length = 841 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = -3 Query: 482 FTAGDRSYPQSNRIYTKLSSLTTFIKENGYVPDLRWVLQD 363 F+AGDRS+PQS++IY KLS L + ++E GY PDLRWV + Sbjct: 799 FSAGDRSHPQSDKIYAKLSILLSSMRETGYDPDLRWVFHE 838