BLASTX nr result
ID: Sinomenium22_contig00042284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042284 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518854.1| ring finger protein, putative [Ricinus commu... 57 3e-06 ref|XP_006343826.1| PREDICTED: RING-H2 zinc finger protein RHA4a... 56 5e-06 >ref|XP_002518854.1| ring finger protein, putative [Ricinus communis] gi|223541841|gb|EEF43387.1| ring finger protein, putative [Ricinus communis] Length = 265 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +1 Query: 1 CIHHWLQANTTCPLCRC-SIISTTRLHSHSQQNPPFTNSQESNSDDQHPHQELTISHLE 174 CIHHWL +NTTCPLCR II TT+L + Q P T+ N D + + + I+ LE Sbjct: 131 CIHHWLHSNTTCPLCRSFVIIPTTKLDNQDQSGGPDTSPPPYNQDHANSNHHIQIASLE 189 >ref|XP_006343826.1| PREDICTED: RING-H2 zinc finger protein RHA4a-like [Solanum tuberosum] Length = 152 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/58 (39%), Positives = 36/58 (62%) Frame = +1 Query: 1 CIHHWLQANTTCPLCRCSIISTTRLHSHSQQNPPFTNSQESNSDDQHPHQELTISHLE 174 CI HWL++N +CPLCRC ++ T + QQ PP N+ S +++ H ++T+S E Sbjct: 50 CIRHWLRSNFSCPLCRCHVLVTNKKPQPPQQ-PPSNNNPSSVIEEEREHHDITVSREE 106