BLASTX nr result
ID: Sinomenium22_contig00042264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042264 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293756.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006362578.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006413926.1| hypothetical protein EUTSA_v10027430mg, part... 46 5e-06 ref|XP_007024941.1| Pentatricopeptide repeat superfamily protein... 56 6e-06 ref|XP_007024939.1| Pentatricopeptide repeat (PPR-like) superfam... 56 6e-06 ref|XP_004233900.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 ref|XP_002528370.1| pentatricopeptide repeat-containing protein,... 55 8e-06 >ref|XP_004293756.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Fragaria vesca subsp. vesca] Length = 705 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSACY 65 WIR + +RKL CE KV + A FFHK +D+DQNVD +T AF +ACY Sbjct: 638 WIRT--VNTLVRKLCCEKKVGIAALFFHKLVDKDQNVDRVTLQAFTTACY 685 >ref|XP_006362578.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X1 [Solanum tuberosum] gi|565393841|ref|XP_006362579.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X2 [Solanum tuberosum] gi|565393843|ref|XP_006362580.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like isoform X3 [Solanum tuberosum] Length = 716 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSACYAATS 53 WIR + +RKL E V+V A FFHK LD+ Q+VD +T AAFMSACY + + Sbjct: 644 WIRT--VSTLVRKLCSEKNVDVAALFFHKLLDKQQSVDRVTLAAFMSACYESNN 695 >ref|XP_006413926.1| hypothetical protein EUTSA_v10027430mg, partial [Eutrema salsugineum] gi|557115096|gb|ESQ55379.1| hypothetical protein EUTSA_v10027430mg, partial [Eutrema salsugineum] Length = 677 Score = 46.2 bits (108), Expect(2) = 5e-06 Identities = 23/49 (46%), Positives = 31/49 (63%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSAC 68 WIR ++ +RKL E K+ V A FF K L++D N D +T AAF +AC Sbjct: 610 WIRT--VRTLVRKLCSEKKIGVAALFFQKLLEKDGNADRVTLAAFTTAC 656 Score = 29.6 bits (65), Expect(2) = 5e-06 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 332 LH*SLIDKGHAPCEVTHMTMVHESC 258 L+ ++IDKG +P EVT +T+ +E C Sbjct: 566 LYEAMIDKGISPSEVTRVTIAYEYC 590 >ref|XP_007024941.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508780307|gb|EOY27563.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 738 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSACY 65 W+R + IRKL E KV + A FFH+ LD+D+NVD +T AAFM+ACY Sbjct: 671 WMRT--VNTLIRKLCSEKKVGIAALFFHRLLDKDRNVDRVTLAAFMTACY 718 >ref|XP_007024939.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] gi|508780305|gb|EOY27561.1| Pentatricopeptide repeat (PPR-like) superfamily protein [Theobroma cacao] Length = 692 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/50 (54%), Positives = 35/50 (70%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSACY 65 W+R + IRKL E KV + A FFH+ LD+D+NVD +T AAFM+ACY Sbjct: 625 WMRT--VNTLIRKLCSEKKVGIAALFFHRLLDKDRNVDRVTLAAFMTACY 672 >ref|XP_004233900.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Solanum lycopersicum] Length = 716 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/62 (50%), Positives = 37/62 (59%) Frame = -1 Query: 250 TTPLLHWLPWTDWIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSA 71 T LL L W+R + +RKL E V V A FFHK LD+ Q+VD +T AAFMSA Sbjct: 632 TMGLLDKLEKKLWVRT--VSTLVRKLCSEKNVNVAALFFHKLLDKQQSVDRVTLAAFMSA 689 Query: 70 CY 65 CY Sbjct: 690 CY 691 >ref|XP_002528370.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532238|gb|EEF34042.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 712 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/50 (60%), Positives = 33/50 (66%) Frame = -1 Query: 214 WIRNFGLKLSIRKLTCEGKVEVVASFFHKFLDEDQNVDHIT*AAFMSACY 65 WIR + IRKL E KV V A FFHK LD+D NVD IT AAF +ACY Sbjct: 645 WIRT--VNTLIRKLCSEKKVGVAALFFHKLLDKDLNVDRITLAAFTTACY 692