BLASTX nr result
ID: Sinomenium22_contig00042231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042231 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342297.1| PREDICTED: translation factor GUF1 homolog, ... 102 4e-20 ref|XP_006342295.1| PREDICTED: translation factor GUF1 homolog, ... 102 4e-20 ref|XP_006842146.1| hypothetical protein AMTR_s00078p00125860 [A... 102 4e-20 ref|XP_004234777.1| PREDICTED: translation factor GUF1 homolog, ... 102 4e-20 emb|CBI22168.3| unnamed protein product [Vitis vinifera] 102 4e-20 ref|XP_002517483.1| GTP-binding protein lepA, putative [Ricinus ... 102 4e-20 ref|XP_002277245.1| PREDICTED: translation factor GUF1 homolog, ... 102 4e-20 ref|XP_004489159.1| PREDICTED: translation factor GUF1 homolog, ... 102 5e-20 ref|XP_003533605.1| PREDICTED: translation factor GUF1 homolog, ... 102 5e-20 ref|XP_006655783.1| PREDICTED: translation factor GUF1 homolog, ... 101 1e-19 ref|XP_004964533.1| PREDICTED: translation factor GUF1 homolog, ... 101 1e-19 gb|EMT27629.1| GTP-binding GUF1-like protein [Aegilops tauschii] 101 1e-19 ref|NP_001056783.1| Os06g0144800 [Oryza sativa Japonica Group] g... 101 1e-19 gb|AFW85886.1| putative translation elongation factor family pro... 101 1e-19 ref|XP_003557212.1| PREDICTED: translation factor GUF1 homolog, ... 101 1e-19 dbj|BAK02058.1| predicted protein [Hordeum vulgare subsp. vulgare] 101 1e-19 ref|XP_002437814.1| hypothetical protein SORBIDRAFT_10g003070 [S... 101 1e-19 sp|B8B2R1.1|GUF1_ORYSI RecName: Full=Translation factor GUF1 hom... 101 1e-19 gb|ABL85044.1| GTP binding protein [Brachypodium sylvaticum] 101 1e-19 ref|XP_007139818.1| hypothetical protein PHAVU_008G061200g [Phas... 100 2e-19 >ref|XP_006342297.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X3 [Solanum tuberosum] gi|565350689|ref|XP_006342298.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X4 [Solanum tuberosum] Length = 540 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 489 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 540 >ref|XP_006342295.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565350685|ref|XP_006342296.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 659 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 608 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 659 >ref|XP_006842146.1| hypothetical protein AMTR_s00078p00125860 [Amborella trichopoda] gi|548844195|gb|ERN03821.1| hypothetical protein AMTR_s00078p00125860 [Amborella trichopoda] Length = 305 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 254 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 305 >ref|XP_004234777.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform 1 [Solanum lycopersicum] Length = 660 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 609 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 660 >emb|CBI22168.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 465 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 516 >ref|XP_002517483.1| GTP-binding protein lepA, putative [Ricinus communis] gi|317411652|sp|B9RUN8.1|GUF1_RICCO RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|223543494|gb|EEF45025.1| GTP-binding protein lepA, putative [Ricinus communis] Length = 673 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 622 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 673 >ref|XP_002277245.1| PREDICTED: translation factor GUF1 homolog, mitochondrial [Vitis vinifera] Length = 681 Score = 102 bits (255), Expect = 4e-20 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGDV+RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 630 AMRKNVLAKCYGGDVTRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 681 >ref|XP_004489159.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Cicer arietinum] Length = 664 Score = 102 bits (254), Expect = 5e-20 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 613 AMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 664 >ref|XP_003533605.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X1 [Glycine max] gi|571479382|ref|XP_006587844.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like isoform X2 [Glycine max] Length = 675 Score = 102 bits (254), Expect = 5e-20 Identities = 49/52 (94%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RKRKLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 624 AMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 675 >ref|XP_006655783.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Oryza brachyantha] Length = 664 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 610 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 661 >ref|XP_004964533.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Setaria italica] Length = 665 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 611 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 662 >gb|EMT27629.1| GTP-binding GUF1-like protein [Aegilops tauschii] Length = 630 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 576 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 627 >ref|NP_001056783.1| Os06g0144800 [Oryza sativa Japonica Group] gi|75109937|sp|Q5VQ69.1|GUF1_ORYSJ RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|55296361|dbj|BAD68406.1| putative GTP-binding membrane protein LepA [Oryza sativa Japonica Group] gi|113594823|dbj|BAF18697.1| Os06g0144800 [Oryza sativa Japonica Group] gi|222634942|gb|EEE65074.1| hypothetical protein OsJ_20104 [Oryza sativa Japonica Group] Length = 663 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 609 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 660 >gb|AFW85886.1| putative translation elongation factor family protein [Zea mays] Length = 665 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 611 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 662 >ref|XP_003557212.1| PREDICTED: translation factor GUF1 homolog, mitochondrial-like [Brachypodium distachyon] Length = 667 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 613 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 664 >dbj|BAK02058.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 666 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 612 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 663 >ref|XP_002437814.1| hypothetical protein SORBIDRAFT_10g003070 [Sorghum bicolor] gi|317411653|sp|C5Z3W1.1|GUF1_SORBI RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|241916037|gb|EER89181.1| hypothetical protein SORBIDRAFT_10g003070 [Sorghum bicolor] Length = 665 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 611 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 662 >sp|B8B2R1.1|GUF1_ORYSI RecName: Full=Translation factor GUF1 homolog, mitochondrial; AltName: Full=Elongation factor 4 homolog; Short=EF-4; AltName: Full=GTPase GUF1 homolog; AltName: Full=Ribosomal back-translocase; Flags: Precursor gi|218197550|gb|EEC79977.1| hypothetical protein OsI_21607 [Oryza sativa Indica Group] Length = 648 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 594 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 645 >gb|ABL85044.1| GTP binding protein [Brachypodium sylvaticum] Length = 667 Score = 101 bits (251), Expect = 1e-19 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RK+KLLEKQKEGKKRMKRVGSVDIPQEAFHEL KVS Sbjct: 613 AMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDIPQEAFHELLKVS 664 >ref|XP_007139818.1| hypothetical protein PHAVU_008G061200g [Phaseolus vulgaris] gi|561012951|gb|ESW11812.1| hypothetical protein PHAVU_008G061200g [Phaseolus vulgaris] Length = 676 Score = 100 bits (250), Expect = 2e-19 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = +3 Query: 3 AMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKRVGSVDIPQEAFHELFKVS 158 AMRKNVLAKCYGGD++RKRKLLEKQKEGKKRMKR+GSVDIPQEAFH+L KVS Sbjct: 625 AMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKRIGSVDIPQEAFHQLLKVS 676