BLASTX nr result
ID: Sinomenium22_contig00042176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042176 (286 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT12269.1| ATPase family AAA domain-containing protein 2B [A... 57 3e-06 gb|EMS58004.1| ATPase family AAA domain-containing protein 2B [T... 57 3e-06 ref|XP_006660845.1| PREDICTED: ATPase family AAA domain-containi... 55 1e-05 ref|XP_004957343.1| PREDICTED: ATPase family AAA domain-containi... 55 1e-05 ref|NP_001063664.1| Os09g0515100 [Oryza sativa Japonica Group] g... 55 1e-05 ref|XP_003578439.1| PREDICTED: ATPase family AAA domain-containi... 55 1e-05 gb|EEE70046.1| hypothetical protein OsJ_30004 [Oryza sativa Japo... 55 1e-05 gb|EEC84880.1| hypothetical protein OsI_32034 [Oryza sativa Indi... 55 1e-05 >gb|EMT12269.1| ATPase family AAA domain-containing protein 2B [Aegilops tauschii] Length = 1206 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP+KEGKHR +SPRRVL Sbjct: 211 RRRYDLRDRAEVRRPSPQKEGKHRPQSPRRVL 242 >gb|EMS58004.1| ATPase family AAA domain-containing protein 2B [Triticum urartu] Length = 1263 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP+KEGKHR +SPRRVL Sbjct: 247 RRRYDLRDRAEVRRPSPQKEGKHRPQSPRRVL 278 >ref|XP_006660845.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like [Oryza brachyantha] Length = 1199 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 212 RRRYDLRDRSEVRRPSPHKEGKHRTQSPRRVL 243 >ref|XP_004957343.1| PREDICTED: ATPase family AAA domain-containing protein At1g05910-like [Setaria italica] Length = 1198 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 214 RRRYDLRDRSEVRRPSPRKEGKHRPQSPRRVL 245 >ref|NP_001063664.1| Os09g0515100 [Oryza sativa Japonica Group] gi|50725359|dbj|BAD34431.1| bromodomain protein 103-like [Oryza sativa Japonica Group] gi|113631897|dbj|BAF25578.1| Os09g0515100 [Oryza sativa Japonica Group] Length = 1198 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 211 RRRYDLRDRSEVRRPSPRKEGKHRTQSPRRVL 242 >ref|XP_003578439.1| PREDICTED: ATPase family AAA domain-containing protein 2B-like [Brachypodium distachyon] Length = 1195 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 208 RRRYDLRDRSEVRRPSPRKEGKHRPQSPRRVL 239 >gb|EEE70046.1| hypothetical protein OsJ_30004 [Oryza sativa Japonica Group] Length = 1200 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 232 RRRYDLRDRSEVRRPSPRKEGKHRTQSPRRVL 263 >gb|EEC84880.1| hypothetical protein OsI_32034 [Oryza sativa Indica Group] Length = 1113 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 190 RRRYDLRNRVEVRRLSPEKEGKHRQRSPRRVL 285 RRRYDLR+R EVRR SP KEGKHR +SPRRVL Sbjct: 247 RRRYDLRDRSEVRRPSPRKEGKHRTQSPRRVL 278