BLASTX nr result
ID: Sinomenium22_contig00042146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium22_contig00042146 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007049589.1| SKU5 similar 3 [Theobroma cacao] gi|50870185... 58 2e-06 ref|XP_004292333.1| PREDICTED: monocopper oxidase-like protein S... 57 3e-06 ref|XP_002321241.2| hypothetical protein POPTR_0014s17590g [Popu... 56 5e-06 ref|XP_006447987.1| hypothetical protein CICLE_v10014680mg [Citr... 56 6e-06 >ref|XP_007049589.1| SKU5 similar 3 [Theobroma cacao] gi|508701850|gb|EOX93746.1| SKU5 similar 3 [Theobroma cacao] Length = 594 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = +3 Query: 3 PLPDNAIYCGVLSYLQKDQAQRVSFSGTVSVANVSGRTILI 125 PLP+NAIYCG+LS LQKDQAQRV+FSG S+++ S +T+ I Sbjct: 543 PLPENAIYCGILSSLQKDQAQRVNFSGAPSISD-SSKTVFI 582 >ref|XP_004292333.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Fragaria vesca subsp. vesca] Length = 588 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +3 Query: 6 LPDNAIYCGVLSYLQKDQAQRVSFSGTVSVANVSGRTILI 125 LPDNAIYCGVLS LQKDQAQRV FSG+ SV + S TIL+ Sbjct: 539 LPDNAIYCGVLSSLQKDQAQRVKFSGSPSV-SCSSTTILV 577 >ref|XP_002321241.2| hypothetical protein POPTR_0014s17590g [Populus trichocarpa] gi|550324430|gb|EEE99556.2| hypothetical protein POPTR_0014s17590g [Populus trichocarpa] Length = 590 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 3 PLPDNAIYCGVLSYLQKDQAQRVSFSGTVSVANVSGRTILI 125 PLPDN IYCG+LS LQKDQA+R SFSG S+A+ S RT L+ Sbjct: 538 PLPDNTIYCGILSSLQKDQARRFSFSGAPSLASPS-RTFLV 577 >ref|XP_006447987.1| hypothetical protein CICLE_v10014680mg [Citrus clementina] gi|568878495|ref|XP_006492225.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Citrus sinensis] gi|557550598|gb|ESR61227.1| hypothetical protein CICLE_v10014680mg [Citrus clementina] Length = 595 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 6 LPDNAIYCGVLSYLQKDQAQRVSFSGTVSVANVSGRTILIA 128 LPDNAIYCG+LS LQKDQAQR++FSG SV + S T+L+A Sbjct: 545 LPDNAIYCGLLSSLQKDQAQRINFSGAPSVVDAS-ITVLLA 584